KEGG   Shewanella baltica BA175: Sbal175_2501Help
Entry
Sbal175_2501      CDS       T02014                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sbb  Shewanella baltica BA175
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sbal175_2501
   03410 Base excision repair
    Sbal175_2501
   03420 Nucleotide excision repair
    Sbal175_2501
   03430 Mismatch repair
    Sbal175_2501
Enzymes [BR:sbb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sbal175_2501
    6.5.1.6  DNA ligase (ATP or NAD+)
     Sbal175_2501
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Sbal175_2501
DNA replication proteins [BR:sbb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Sbal175_2501
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Sbal175_2501
DNA repair and recombination proteins [BR:sbb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Sbal175_2501
   NER (nucleotide excision repair)
    Other NER factors
     Sbal175_2501
   MMR (mismatch exicision repair)
    Other MMR factors
     Sbal175_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2960696..2961625)
Genome map
AA seq 309 aa AA seqDB search
MTHTSPLQDLTFHRFIRFRFFKQRLLLLSLLIFGCLAPVTYAQNSPPSIQLATEFDAQQE
IHIQDFLISEKLDGVRGYWNGQALLTRQGNLIAVPTWFIANFPNYPLDGELWLGRGQFEA
MSSIVRQTSAKDDDWRKVRFMVFDVPKAGGDFQHRYQFALAELSDKSHYLEVIAQFQVDS
LEALYQKLDSLVAKGAEGLMLHRSSATYVSGRNPNLMKLKPYYDAEATVIGHIPGKGQFA
GQMGAIRVQTPDGRIFNIGTGFNLAERQHPPAVGAIITYKYLGLTVNGLPRFASFLRVRV
DIDKIDSQQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgactcataccagcccgttacaagatttaacatttcatcggtttatccgctttcgtttt
ttcaaacaacgcctgctcttactcagtctgctgatattcggttgtttagccccagtgacc
tatgcgcaaaactctccaccttcgatacagttggcaactgagtttgatgcccagcaagag
attcatattcaggactttttgattagcgaaaaactcgacggggtgcgaggttactggaat
ggtcaggcactattgacccggcaaggtaatcttattgctgttccgacatggtttatcgcg
aatttcccgaattatcccctcgatggtgagttatggcttgggcgaggccagtttgaggct
atgtcgagcatagttcgacaaacctcagccaaggatgatgattggcgcaaagtgcgattt
atggtgttcgatgttcccaaggcgggtggcgactttcagcatcgctatcaatttgcgttg
gccgaattaagcgataaatcgcattatcttgaagttatagcgcagttccaagtggacagt
cttgaagctctgtatcaaaaacttgatagcttagttgctaaaggcgctgaaggattaatg
ctgcatcgcagctcagcgacgtatgtcagtggccgcaatcctaatttgatgaaattaaaa
ccctattatgatgctgaagcgacagtgatcggccatataccagggaaaggtcaatttgca
gggcaaatgggtgcaataagagtgcaaaccccagacggccggattttcaacataggcaca
ggttttaatctcgcagagcgccaacatccccccgcagtgggcgcaatcatcacctataaa
tatctgggtcttaccgtaaatggcttacccagatttgccagtttcctgcgagtacgcgtc
gatatagataagatcgacagtcaacaatag

DBGET integrated database retrieval system