KEGG   Salmonella bongori NCTC 12419: SBG_2417Help
Entry
SBG_2417          CDS       T01579                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00250  Alanine, aspartate and glutamate metabolism
sbg00280  Valine, leucine and isoleucine degradation
sbg00410  beta-Alanine metabolism
sbg00640  Propanoate metabolism
sbg00650  Butanoate metabolism
sbg01100  Metabolic pathways
sbg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBG_2417 (gabT)
   00650 Butanoate metabolism
    SBG_2417 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBG_2417 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SBG_2417 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBG_2417 (gabT)
Enzymes [BR:sbg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SBG_2417 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SBG_2417 (gabT)
Amino acid related enzymes [BR:sbg01007]
 Aminotransferase (transaminase)
  Class III
   SBG_2417 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCC31476
UniProt: A0A0K0HCY7
LinkDB All DBs
Position
2665721..2667004
Genome map
AA seq 427 aa AA seqDB search
MNTNKALMQRRDDAVPRGVGQIHPIFAERAENCRVWDVEGHEYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCPLHGISD
DDAIASIERIFKNDAAPEDIATIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEHENLLQKANTLGKTLRDGLMEIAETHHEIGDVRGLGAMIAIELF
EKGAPGKPNAALAADIVARARDKGLILLSCGPYHNILRILVPLTIEAPQIRQGLEIIAQC
FDEAKQR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataaagcattaatgcagcgccgtgatgacgccgtccctcgcggcgtgggt
cagattcaccctatattcgccgaacgggcagaaaattgtcgcgtctgggatgtggaaggc
cacgaatatcttgatttcgcgggtggcattgccgtcctcaataccggtcatttacatccg
ggcattgtttcagcggtcgaagcgcagttgaagaaattgtcgcatacctgttttcaggtg
ctggcctatgagccctatctggcgttgtgcgaacgcatgaatcaaaaggtaccaggtgat
ttcgccaaaaaaacattgctggtaacaaccggttctgaagcagttgaaaacgcggtgaaa
atcgcccgcgcagcaaccaaacgtagcggcgctatcgcctttagcggcgcttaccacgga
cgcacccactacacgctctcgctaaccgggaaagtaaacccttactccgctggcatgggg
ttgatgccaggccatgtctaccgcgcgctttatccctgcccattacacggcatcagcgat
gacgacgcgatcgccagcattgaacgcatttttaaaaatgatgccgcgccggaagatatc
gccaccataattattgaaccggtccagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgacttcgtgcgctatgcgaccaacacggcattatgctgatcgccgatgag
gtgcaaagtggcgcaggtcgtaccggtacactgttcgctatggagcagatgggtgttgca
gcggatatcaccacttttgcaaaatcgattgccggtggtttcccgctggcaggcgtcact
ggccgggcggaggtgatggacgccatcgcaccgggtggcctgggcggtacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcacgaaaatctg
ctgcaaaaagcgaatacgcttggcaaaacgctacgcgatggcctgatggagatagcggaa
actcaccatgaaattggcgacgtccgcgggctgggcgccatgatcgctatcgagttgttc
gaaaaaggcgcccccggtaaaccgaacgcagcgctggccgccgatattgttgcccgcgcc
cgcgacaaagggctgattctgctgtcatgcggtccttaccacaatatcctgcgcatcctc
gtcccactgacaattgaagcgccccagattcggcaaggtctggagattatcgctcagtgt
tttgatgaggcgaaacaacgctaa

DBGET integrated database retrieval system