KEGG   Salmonella bongori NCTC 12419: SBG_3692Help
Entry
SBG_3692          CDS       T01579                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00473  D-Alanine metabolism
sbg01100  Metabolic pathways
sbg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SBG_3692 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SBG_3692 (alr)
Enzymes [BR:sbg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SBG_3692 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sbg01011]
 Precursor biosynthesis
  Racemase
   SBG_3692 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCC32738
UniProt: A0A0K0HH56
LinkDB All DBs
Position
4095836..4096915
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGIKQPILLLEGFFDAADLPTISVQRLHTAVHNQEQLAALEAAELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLAHCKNVRQPVNIVSHFARADEPECGATEHQLEIFNA
FCGDKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAARDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPSAQDKAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgtcgtcattaaccgccgcgctctgcgacacaacctgcaacgactg
cgtgaactggcgcctgccagcaaactggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgccgacgcttttggcgttgcgcgcctt
gaagaagctctacgtctgcgagcgggcgggatcaagcagcctattctgctgctggagggg
ttcttcgacgccgccgatctgccgaccatttctgttcaacgcctgcataccgccgtgcat
aatcaggagcagcttgccgccctggaagctgcggaactggcggaaccggtaacggtgtgg
atgaagcttgataccgggatgcatcggctcggcgtgcgtccggaagaggcggaggcgttc
taccaacgtctggcgcactgtaaaaatgtacgccagccggtgaatatcgttagccatttt
gcgcgcgcggatgagccggagtgcggcgctaccgagcatcagcttgaaatttttaacgcc
ttctgcggggataaaccgggacagcgctccattgccgcctctggcggcattttgctgtgg
ccgcaatctcactttgactgggcgcgtccgggcatcattctttacggcgtatcgccgttg
gaacacaaaccctggggaccggattttggttttcagccggtcatgtctttaacgtccagc
ctgatcgcggcgcgcgaccacaaagcgggcgagccggtgggctacggcgggacatgggtg
agtgagcgcgatacgcgcctgggcgtggtggcgatgggctatggcgatggttatccacgc
gcggcgccttccggtacgccggtgctggttaacggtcgcgaggttccgattgtcgggcgg
gtggctatggatatgatttgtgtggatctgggacccagcgcccaggataaagcgggcgat
ccggttgtgttatggggtgaagggctgccggttgaacgtattgctgaaatgacaaaagta
agcgcttacgaacttatcacgcgtctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system