KEGG   Streptomyces bingchenggensis: SBI_03734Help
Entry
SBI_03734         CDS       T01678                                 

Gene name
pykA1
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00230  Purine metabolism
sbh00620  Pyruvate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
sbh01230  Biosynthesis of amino acids
Module
sbh_M00002  Glycolysis, core module involving three-carbon compounds
sbh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_03734 (pykA1)
   00620 Pyruvate metabolism
    SBI_03734 (pykA1)
  Nucleotide metabolism
   00230 Purine metabolism
    SBI_03734 (pykA1)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SBI_03734 (pykA1)
Membrane trafficking [BR:sbh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SBI_03734 (pykA1)
Exosome [BR:sbh04147]
 Exosomal proteins
  Proteins found in most exosomes
   SBI_03734 (pykA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI CorC_HlyC
Motif
Other DBs
NCBI-ProteinID: ADI06855
UniProt: D7CFU7
LinkDB All DBs
Position
4814127..4815554
Genome map
AA seq 475 aa AA seqDB search
MRRSKIVCTLGPAVDSYDQLKSLIEAGMNVARFNMSHGSHPEHEERYHRVRKASEETGRA
VGVLADLQGPKIRLETFADGPVELMRGDEFTITTEDVPGDRTICGTTYKGLPGDVSKGDQ
VLINDGNVELRVTAVDGPRVKTIVIEGGVISDHKGINLPGTAVNVPALSEKDIVDLKFAL
AMGCDMVALSFVRDAADVRDVHRVMDEVGHRVPVIAKVEKPQAVANMEEVVAAFDGVMVA
RGDLAVEYPLEKVPMVQKRLIELCRRNAKPVIVATQMMESMITNSRPTRAEASDVANAIL
DGADAVMLSAESSVGAYPLETVKTMSRIVQAAEQELLSRGLQPLVPGKKPRTQGGSVARA
ACEIADFLDAQSLVAFTQSGDTARRLSRYRAQQPILAFTTDVATRNQLTLSWGVESFVVP
YVEHTDAMVDLVDAELSKLGRYNEGDTMIMTAGSPPGVPGTTNMVRVHHLSGRSK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttccaaaatcgtctgcactctgggccccgccgtcgactcctacgaccagctg
aagtcgctgatcgaggccgggatgaacgtggcccgattcaatatgagccacgggagccac
ccggagcacgaggagcggtaccaccgcgtccgcaaggcctccgaggagaccggacgggcg
gtcggcgtgctcgccgacctccagggccccaagatccggctggagaccttcgccgacggc
ccggtggagctgatgcgcggtgacgagttcaccatcaccaccgaggacgtgccgggcgac
cggacgatctgcggcaccacgtacaaggggctgccgggcgacgtctccaagggcgaccag
gtcctgatcaacgacggcaatgtcgagctgcgggtcaccgcggtcgacggcccgcgggtc
aagacgatcgtcatcgagggcggtgtgatctccgaccacaaggggatcaacctgccgggc
actgcggtcaatgtgcccgcgctgtccgagaaggacatcgttgacctcaagttcgccctg
gcgatggggtgcgacatggtcgcgctgtccttcgtccgggacgccgccgacgtccgcgat
gtgcaccgcgtcatggacgaggtggggcaccgggtgccggtgatcgccaaggtcgagaag
ccgcaggcggtcgccaacatggaggaggtcgtcgcggccttcgacggcgtcatggtggcc
cgcggcgacctggccgtcgagtatccgctcgagaaggtcccgatggtgcagaagcgcctg
atcgagctgtgccggcggaacgccaagccggtgatcgtcgcgacccagatgatggagtcg
atgatcaccaactcgcggccgacccgcgccgaggcgtccgacgtcgccaacgcgatcctg
gacggcgccgacgcggtcatgctctccgcggagtcctccgtcggcgcgtatccgctggag
acggtcaagacgatgtcccgcatcgtccaggccgccgagcaggagctgctctcgcgcggt
ctgcagccgctggtccccggcaagaagccgcgtacgcagggcggctcggtcgcccgcgcg
gcctgcgagatcgccgacttcctggacgcccagtcgctggtggccttcacccagtccggc
gacaccgcccgccggctgtcccgctaccgggcccagcagccgatcctggccttcaccacc
gatgtggccacccgcaaccagctgacgctcagctggggcgtggagtcgttcgtggtgccg
tatgtggagcacaccgacgcgatggtggacctcgtcgacgccgagctgtcgaagctgggc
cgctacaacgagggcgacaccatgatcatgacggccggttcgccccccggcgtccccggc
accaccaacatggtccgggtgcaccacctgagcggcaggagcaagtag

DBGET integrated database retrieval system