KEGG   Streptomyces bingchenggensis: SBI_03734Help
Entry
SBI_03734         CDS       T01678                                 

Gene name
pykA1
Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_03734 (pykA1)
   01230 Biosynthesis of amino acids
    SBI_03734 (pykA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_03734 (pykA1)
   00620 Pyruvate metabolism
    SBI_03734 (pykA1)
  Nucleotide metabolism
   00230 Purine metabolism
    SBI_03734 (pykA1)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SBI_03734 (pykA1)
Exosome [BR:sbh04147]
 Exosomal proteins
  Proteins found in most exosomes
   SBI_03734 (pykA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
4814127..4815554
Genome map
AA seq 475 aa AA seqDB search
MRRSKIVCTLGPAVDSYDQLKSLIEAGMNVARFNMSHGSHPEHEERYHRVRKASEETGRA
VGVLADLQGPKIRLETFADGPVELMRGDEFTITTEDVPGDRTICGTTYKGLPGDVSKGDQ
VLINDGNVELRVTAVDGPRVKTIVIEGGVISDHKGINLPGTAVNVPALSEKDIVDLKFAL
AMGCDMVALSFVRDAADVRDVHRVMDEVGHRVPVIAKVEKPQAVANMEEVVAAFDGVMVA
RGDLAVEYPLEKVPMVQKRLIELCRRNAKPVIVATQMMESMITNSRPTRAEASDVANAIL
DGADAVMLSAESSVGAYPLETVKTMSRIVQAAEQELLSRGLQPLVPGKKPRTQGGSVARA
ACEIADFLDAQSLVAFTQSGDTARRLSRYRAQQPILAFTTDVATRNQLTLSWGVESFVVP
YVEHTDAMVDLVDAELSKLGRYNEGDTMIMTAGSPPGVPGTTNMVRVHHLSGRSK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttccaaaatcgtctgcactctgggccccgccgtcgactcctacgaccagctg
aagtcgctgatcgaggccgggatgaacgtggcccgattcaatatgagccacgggagccac
ccggagcacgaggagcggtaccaccgcgtccgcaaggcctccgaggagaccggacgggcg
gtcggcgtgctcgccgacctccagggccccaagatccggctggagaccttcgccgacggc
ccggtggagctgatgcgcggtgacgagttcaccatcaccaccgaggacgtgccgggcgac
cggacgatctgcggcaccacgtacaaggggctgccgggcgacgtctccaagggcgaccag
gtcctgatcaacgacggcaatgtcgagctgcgggtcaccgcggtcgacggcccgcgggtc
aagacgatcgtcatcgagggcggtgtgatctccgaccacaaggggatcaacctgccgggc
actgcggtcaatgtgcccgcgctgtccgagaaggacatcgttgacctcaagttcgccctg
gcgatggggtgcgacatggtcgcgctgtccttcgtccgggacgccgccgacgtccgcgat
gtgcaccgcgtcatggacgaggtggggcaccgggtgccggtgatcgccaaggtcgagaag
ccgcaggcggtcgccaacatggaggaggtcgtcgcggccttcgacggcgtcatggtggcc
cgcggcgacctggccgtcgagtatccgctcgagaaggtcccgatggtgcagaagcgcctg
atcgagctgtgccggcggaacgccaagccggtgatcgtcgcgacccagatgatggagtcg
atgatcaccaactcgcggccgacccgcgccgaggcgtccgacgtcgccaacgcgatcctg
gacggcgccgacgcggtcatgctctccgcggagtcctccgtcggcgcgtatccgctggag
acggtcaagacgatgtcccgcatcgtccaggccgccgagcaggagctgctctcgcgcggt
ctgcagccgctggtccccggcaagaagccgcgtacgcagggcggctcggtcgcccgcgcg
gcctgcgagatcgccgacttcctggacgcccagtcgctggtggccttcacccagtccggc
gacaccgcccgccggctgtcccgctaccgggcccagcagccgatcctggccttcaccacc
gatgtggccacccgcaaccagctgacgctcagctggggcgtggagtcgttcgtggtgccg
tatgtggagcacaccgacgcgatggtggacctcgtcgacgccgagctgtcgaagctgggc
cgctacaacgagggcgacaccatgatcatgacggccggttcgccccccggcgtccccggc
accaccaacatggtccgggtgcaccacctgagcggcaggagcaagtag

DBGET integrated database retrieval system