KEGG   Streptomyces bingchenggensis: SBI_07645Help
Entry
SBI_07645         CDS       T01678                                 

Definition
(GenBank) acyl-CoA synthetase
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9068488..9069981
Genome map
AA seq 497 aa AA seqDB search
MLSGQREFIVAFIGMVSAGVIPVPVFPPAMLTRIEAYRERLHSIHSSCEPRHIIADESLF
DICVDAVGTKPIGYAELAAGEPTGELVEAEGGEPLFLQYTSGSTAMPKGVVVTHDNLLEN
ARAMDQALGTSGERDRFVSWLPLYHDMGLIGCMLGPLVYEVPVWFIPPYEFARRPTTWLD
WMSKISGTFSYAPNFAYELVTRRATDKQMAGWDLSAWRGAGVGAEPVRPRTMREFAERFA
GVGFDANAITPSYGLAEGTLGVAFTTIGDGLRTLSVDRAAFEEEGAVRPVEPGAGAEATG
TREIVSCGPLLSGWEARIRAASGEPADESTEGQIEIRGGSVARGYWGARELSEETFRDGW
LRTGDLGFLRDGELYVTGRTKDLVIHHGRKYHPTDIEWSALGLPGVRPDHVIAFSTPDER
LVVVAEHKPASSPPDLAKQIATRVRGSVGVTPDDVVLVKPGTLPKTSSGKLRRAACRDAY
SQGAYSHNGPAGHGGAK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccggtcagcgtgagttcatcgtcgcctttatcggtatggtgagcgccggagtc
atccccgtaccggtgttcccgccggccatgctgacccggatcgaggcctaccgggagcgc
ctgcattcgatccattcgtcctgcgagccgcggcacatcatcgccgacgagtcgcttttc
gacatctgcgtcgacgcggtggggaccaagcccatcggctacgcggagctcgccgccggg
gagccgaccggggagctggtggaggcggagggcggggagccgcttttcctgcagtacacc
tccggctccaccgccatgcccaagggcgtcgtggtcacccacgacaacctcttggagaac
gcccgggccatggaccaggcgctggggacctctggcgaacgtgaccggttcgtcagctgg
ctgccgctgtaccacgacatggggctcatcggctgcatgctcgggccgctggtgtacgag
gtgcccgtctggttcatcccgccctacgaattcgcgcgccggcccactacgtggctggac
tggatgtccaagatctccggcaccttctcctacgcccccaacttcgcctacgagctggtc
acccgccgggcgaccgacaagcagatggccggctgggacctgtccgcgtggcggggggcg
ggggtcggcgcggagccggtccggccgcggaccatgcgggagttcgccgagcggttcgcc
ggcgtcgggttcgacgcgaacgccatcaccccctcctacgggctggcggaaggcaccctc
ggggtggccttcaccacgatcggcgacgggcttcgcacgctgtcggtggaccgtgcggcc
ttcgaggaggagggcgcggtccgcccggtggagcccggggccggggccgaggcgaccggg
acccgcgagatcgtctcctgcgggccgctgctcagcggctgggaagcccgtatccgagcc
gcctccggcgagcccgccgacgagtccaccgaagggcagatcgagatccgcggagggagc
gtcgcgcgcggttactggggggcgcgcgagctttccgaggagaccttccgggacggctgg
ctgcgcaccggcgacctcggctttctgcgcgacggtgagctgtatgtcaccggccggacg
aaggacctggtcattcaccacggccgtaagtaccacccgacggacatcgaatggtccgct
ctggggctcccgggggtccgcccggaccatgtgatcgcgttcagcacccccgacgagcgc
ctggtggtggtcgccgagcacaagccggcgagctcgcccccggacctcgcgaagcagatc
gccacccgggtccgcggttcggtcggggtgacgcccgacgacgtggtgctggtgaagccc
ggcacgctgcccaagaccagcagcggcaaactgcggcgcgccgcctgccgtgacgcgtat
tcccagggcgcgtattcccacaacggccccgcgggccatggaggagccaagtga

DBGET integrated database retrieval system