KEGG   Sorghum bicolor (sorghum): 8070647Help
Entry
8070647           CDS       T01086                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    8070647
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8070647
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     8070647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 169 aa AA seqDB search
MAPTVMASSATAVAPFQGLKSTATLPVARRSTTSLAKVSNGGRIRCMQVWPAYGNKKFET
LSYLPPLTEEQLLKQVDYLLRNNWVPCLEFSKEGFVYRENSTSPCYYDGRYWTMWKLPMF
GCTDASQVYKELQEAIASYPDAYVRILGFDNIKQTQCVSFIAYKPAGSE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaccgtgatggcctcgtccgccaccgccgtcgctccgttccagggtctcaag
tccaccgccaccctccccgtcgcccgccgctccaccaccagcctcgccaaagtcagcaac
ggcggcaggatccggtgcatgcaggtgtggccggcgtacgggaacaagaagttcgagacg
ctgtcgtacctgccgccgctgacggaggagcagctgctgaagcaggtggactacctgctg
cgcaacaactgggtgccctgcctcgagttcagcaaggaaggcttcgtgtaccgcgagaac
tccacctccccgtgctactacgacggccgctactggaccatgtggaagctgcccatgttc
ggctgcaccgacgcgtcgcaggtctacaaggagctgcaggaggccatcgcctcctacccg
gacgcctacgtccggatcctcggcttcgacaacatcaagcagacgcagtgcgtcagcttc
atcgcctacaagcccgcgggcagcgagtga

DBGET integrated database retrieval system