KEGG   Sorghum bicolor (sorghum): 8085534Help
Entry
8085534           CDS       T01086                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     8085534
Chromosome [BR:sbi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     8085534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
4
AA seq 352 aa AA seqDB search
MASTSGDTSAAEALRRGRILSSRLYLDGVPSSKAPVVYSPAYDIEFNGIEKQHPFDSAKW
GRVRNFLVDAGLLQNDRIIEPLEASEDDLLVVHSESYLNSLKSSAKVARIVEVPAVALLP
NLLVQQKLLYPFRKQVGGSILSAKLALERGCAINIGGGFHHCSAEEGGGFCAYADISLCI
HFAFVRLNISRVMIIDLDAHQGNGHEKDFGSDERVYTLDMYNSGIYPFDHVAKKYIDQKI
ELHSGTKTEDYLEILDKALKVAESRFQPQLILYNAGTDILDGDPLGSLKVSPDGVITRDE
KVFRFAKDQSIPLLMLTSGGYMKSSARVIADSIINLSNKNLIDIDTHCIEIE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgacgtcgggggatacatcggcagcggaggctctccgccgcggtcgcatcctc
tccagccgcctctacctcgacggcgtccccagctccaaggcacccgtggtctactcgccg
gcgtatgacatcgagttcaacgggatcgagaaacagcacccgtttgattcggcgaaatgg
ggtcgcgtccgcaacttccttgtggacgcagggctcctccagaacgatcggatcatcgag
ccgctggaagcctccgaggatgatctgctagtggtgcactcagagtcgtacttgaacagc
cttaagagcagcgcgaaggttgcccgcattgtagaggttccagcagtggcactactacct
aacttgcttgttcagcaaaaactcctttatccatttcggaagcaggtgggtggctccatt
ttatcagcaaaacttgcactagaaagaggatgtgctatcaacattggcggaggcttccac
cactgttcggcagaggaagggggtggcttttgtgcatatgctgatatttctctgtgcatc
cattttgcttttgttcgtttaaatatctcaagagtaatgatcattgatctagatgctcac
caaggaaatggccatgaaaaagattttgggagtgatgagagagtttacaccttggacatg
tacaactctggaatatatccttttgatcatgtggctaagaagtacattgatcaaaagatc
gagttacatagtgggacaaaaacagaagattatttggagatccttgataaggctctcaag
gtagctgaaagtagatttcagccccagttgattctgtacaatgctggaactgatatccta
gatggcgatcctttaggcagcctaaaggttagtccagacggtgtgattactagagatgaa
aaggttttcaggtttgcaaaggatcagagtattcctctcctcatgctgacatcaggaggc
tatatgaagtcaagtgctcgggtcatagcagattcaattatcaacctctcgaacaaaaac
ttgatagatattgatacacactgtatagaaattgaataa

DBGET integrated database retrieval system