KEGG   Shewanella baltica OS155: Sbal_4125Help
Entry
Sbal_4125         CDS       T00478                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00620  Pyruvate metabolism
sbl00680  Methane metabolism
sbl01100  Metabolic pathways
sbl01120  Microbial metabolism in diverse environments
sbl01200  Carbon metabolism
Module
sbl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal_4125
  Energy metabolism
   00680 Methane metabolism
    Sbal_4125
Enzymes [BR:sbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sbal_4125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3666
Motif
Other DBs
NCBI-ProteinID: ABN63590
JGI: Sbal4125
UniProt: A3DA27
LinkDB All DBs
Position
4835240..4837909
Genome map
AA seq 889 aa AA seqDB search
MVVTKADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRVDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QISLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLKDIVLLVGELSM
EEANDELKAYTNNSCEPYRHVLRSIRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
APLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQQW
RDCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAASERGEMGLLQDMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaccaaggcagacaatatgaccgatatgtatgcgtcattaagatcgaacgtg
agtatgttaggacaaatcctcggtgacactatgcgcacccacctcggggactcttttctc
gagaaggttgaacagatccgtaaacttgctaaagattcacgccggggcgatcaagccgcc
agagagcaaatgctcgagttactcaccgccctgccagacgaagaattagttccgtttgca
aaggcatttaaccagttcctcaacttagctaatttatctgaacaatttcataccattagc
cgcaactgcgacgaactcgtctgcgtaccagatcccgtggaacagctgctaggccgcatg
ttaaatggccgtgtagaccaaacgaaaatgctcgactgccttaagacactggatatcgat
ctagtgctgacagcgcatcccactgaaatttcccgtcgcactctgatccaaaaatacgcc
gccattgtcgactgcttaactgagcaagaaaacgaccaattatcagatagagagcgtcag
caaatcagtctgcgcctgcgccaattgatcgcgcaaatctggcacaccaatgagatccgc
cgtgagcgcccaacacctgttgatgaagcccgctggggattatcgaccattgaagagtca
ctctggcatgcggtgccagacttcttaagacagcttaacgaccaagtgcaacaacgcacg
ggtcaacaattaccgattgatatcgcgccagtgcgtttttcaagctggatgggcggcgat
cgcgacggcaacccctttgtgaccgcgaaggtcacccaagaggtgctcgatcgcaaccgc
catgccgccgccagattattcttaaaagacatagtcctgctggttggcgagctgtcgatg
gaagaagccaatgatgagttaaaggcttacaccaacaacagctgcgagccataccgccac
gtgttgcgctctattcgtcaaagactgcgtgacaccatagattatttaaatgcgcgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatttggcaagaaagcgatctcaaa
gcgccgttagaaatgctttataagagtttgaccgactgcggtatgcgcttaatcgccaac
ggtctattactcgatattctccgtcgtctcgcctgttttggcattcacatgctcagactc
gatattcgccaagacgccagccgtcacagcgatgtgctcgccgaattgactcgctatctc
ggcatgggtgatttcaaccattgggatgaaaccgagaaacaagccttcctattacgcgaa
ctcagcaaccgtcgtccgctgatcccaagtaactggcagccgtcagccgatgtggccgaa
gtgcttaatacctgtcgtttgatcgcaaaacatccggctaaggcacttggttcctatgtg
atctcgatggcgggtaagccatcggatgtcttaacggttttactgttactcaaagaaacg
ggctgttcgcacccaatgcgcgtggtgccgctgtttgaaaccctaagcgacttaaacaac
gccgcagcctgtattaccgatttactcgatatcgactggtatcgtggttataccaagggc
atgcaagaagtgatgattggctactctgactctgctaaagatgccggcgtaatggcggcg
gcttgggctcagtatcacgctcaagagcagttagtggccgtctgtaaacaagcgggcgtc
aagctcacactattccatggccgcggcggcagcattggtcgcggcggcggtcctgcacac
aaagcgattctatcccaacctccagggtcggtagatggccgtattcgtgtcactgagcaa
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttagctctg
tatacctctgccgtattggaagcaaccctgttaccaccgccagaacccaagcagcaatgg
cgtgattgcatgcaacgtatcgctgaagaatcagtaggagcctatcgtggcatagtgcgt
gatgagcctgattttgtggcttatttccgcgctgcaaccccagaagtggaattaggcaag
ctgccactcggcagccgcccagctaaacgtcgtgtcgatggagggattgaaagcctacgg
gcaattccgtggatttttgcttggtcgcaaaaccgcttgatgttacctgcatggcttggc
gccggtgaagcccttcaagccgccagtgaacgcggtgaaatgggtttactgcaagatatg
gaacgggaatggcccttcttcagcactcgcatttcaatgctagaaatggtctacgccaag
gcggaacctaatttagcccgctactacgaaacctgtttagtaccgaaagacttgcatcac
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacgccgtggaatcgcgagtcagtaaaactgcgaaat
ccgtatatcgatccattaaacttcttacaaaccgagctattagcgcggacacgtaaggaa
acaacagaaactcccgcgtctgaacatgtgcagctagcgctaatgctgactattgcgggt
gtggcagcgggaatgagaaatactggttaa

DBGET integrated database retrieval system