KEGG   Shewanella baltica OS185: Shew185_2043Help
Entry
Shew185_2043      CDS       T00571                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00473  D-Alanine metabolism
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
sbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Shew185_2043
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_2043
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Shew185_2043
Enzymes [BR:sbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Shew185_2043
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Amino acid ligase
   Shew185_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ABS08185
JGI: Shew1852043
UniProt: A6WMZ6
LinkDB All DBs
Position
complement(2444756..2445769)
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGDDCEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFVKAASQGSSVGCYKVDDS
AKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctgcttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctggataaattcggccagtaccgcactgccgctggtgacgactgtgagctg
accaatagccgcgagattcgcttccgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccctgcattcatggctatcccggcgagactggcgacattcaatcctattttaat
ttgatccaactgccctattttggctgcgaatccgaagcgagcagcaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccgtatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaagcggctttagcacaatggggatcg
atcttcgtcaaagcagcctcacagggttcctctgtcggttgttacaaagtggatgacagc
gctaaagtcgcaggcgtgctcaaggatgcttttggctatgcaccctatgtgatcgttgaa
aaaaccattaaagcccgcgagttagaagtggcagtctacgagtacaacggtgaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcgcagcatgtgtcagctgagatc
agtgaacaaatccgcgcctatgcaatcaaggcatttaaaggaatgaagctgcgtcacctg
tcacgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatacc
tttcctggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggtcatgac
tttactgaatacttgagcctagtgattaacggtcagctaaccgctaaatcttag

DBGET integrated database retrieval system