KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028633Help
Entry
101028633         CDS       T04350                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3 isoform X4
  KO
K10776  
DNA ligase 3 [EC:6.5.1.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    101028633 (LIG3)
Enzymes [BR:sbq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101028633 (LIG3)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     101028633 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1013 aa AA seqDB search
MSLTFKILFPQTIRALSQKELYLFRGHHWPDVRQFSQWSETDLLHGQRLFLRRKPVVSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSETGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAASTPKKKAVVQAKLTTTGQVTSPVKGTSFVTSTNPRKFSGFSAKPNTSGESP
SSPTRKISLSSSKCDPRHKDCLLREFRKLCAMVADNSSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDEMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKKPGQRRALSVQASLMTP
VQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVVH
FKDYIPQAFPGGQSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHENMVEIPNRIMFSEMKRVTKASDLADMITRVIREGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
MAGDEGSSTTGGSSEENKGPSGSSVSHKAPSASPNKPYASTKKAEGKLSNSNSKGGNMLT
AKPSPVTVGEKLAMKSSPVKVGEKRKAADETLCQTKVLPDIFTGVRLYLPPSTPDFSRLR
RYFVAFDGDLVQEFDMASATHVLCSRDKNPSAQQVSPEWIWACIRKRRLVAPC
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgactttcaagatcctctttccacaaaccatccgtgcactcagccaaaaagaa
ctgtacctattccgaggacatcactggcctgatgtcagacagttcagccagtggtcagaa
acagatctgcttcatggacagcgcctcttcctgagaagaaagcctgttgtgtcattccag
ggaagccatctaagatcacgtgccacctaccttgttttcttgccagggttgcatgtggga
ctctgcagtggcccctgtgagatggctgagcaacggttctgtgtggactatgccaagcgt
ggcacagctggctgcaaaaaatgcaaggaaaagattgtgaagggcgtatgccgaattggc
aaagtggtaccaaatcccttctcagagactgggggtgatatgaaagagtggtaccacatt
aaatgcatgtttgagaaactagagcgggcccgggccaccacaaaaaaaatcgaggacctc
acagagctggaaggctgggaggagctggaagataacgagaaggaacagataacccagcac
attgcagatctgtcttctaaggcagcaagtacaccaaagaagaaagctgttgtccaggct
aagttgacaaccactggccaggtgacatctccagtgaaaggcacctcatttgtcaccagt
actaatccccggaaattttctggtttttcagccaagcccaacacctctggggaatccccc
tcaagccccacacgtaagataagtctgtcttcaagcaaatgtgaccccagacataaggac
tgtctgctacgggagtttcgaaagttgtgcgccatggtggctgataattctagctacaac
acgaagacccagatcatccaggacttcctgcggaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacagtgaagctgctgctgccaggagtcattaagagtgtttataac
ttgaatgataagcagattgtgaagcttttcagtcgcatttttaactgcaacccagatgag
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtcttttcccccagctgccaagagcctccttaccatccaggaagtggatgagttc
cttctgcggctgtccaagctcaccaaggaggatgagcagcaacaggccctgcaggacatt
gcctccaggtgtacagccaatgaccttaaatgcatcatcaggttgatcaaacatgatctg
aagatgaactcaggtgcaaaacatgtgttagacgcccttgaccccaatgcctatgaagcc
ttcaaagcctcgcgcaacctgcaggacgtggtggagcgggtccttcgcaatgagcaggag
gtggagaagaagccaggccagagacgagctctgagcgtccaggcctcactgatgacacct
gtgcagcccatgctggcggaggcctgcaagtccattgagtatgcaatgaagaagtgtccc
aatggcatgttctctgagatcaagtacgatggagagcgagtccaagtgcataagaatggg
gaccacttcagctacttcagccgcagtctcaagcccgtgctgcctcacaaggtggtccac
tttaaggactacatccctcaggcttttcctgggggccaaagcatgatcttggactctgag
gtgcttctgattgacaacaagacagggaaaccactgccctttgggaccctcggagtgcac
aagaaagcggccttccaggatgccaatgtctgcctgtttgtttttgattgtatctacttt
aatgatgtcagcttgatggacaggcctctgtgtgagcggcggaagtttcttcatgagaac
atggttgaaattccaaaccggatcatgttctcagaaatgaaacgagtcacaaaagcttcg
gacttggctgacatgataacccgggtgatccgggagggattggaggggctggtgctgaag
gatgtgaagggtacatatgagcctgggaagcggcactggctgaaagtgaagaaagactat
ttgaatgagggggccatggccgacacagctgacctggtggtccttggggccttctatggg
caagggagcaaaggcggcatgatgtcaatcttcctcatgggctgctacgaccctggaagc
cagaagtggtgcacagtcaccaagtgtgcaggaggccatgacgatgccacacttgcccgc
cttcagaaggaactagacatggtgaagatcagcaaggaccccagcaaaatacccagctgg
ctgaaggtcaacaagatctactatcctgacttcatcgttccagacccaaagaaagctgcc
gtgtgggagatcacaggggctgaattctccaaatcggaggctcacacagctgacgggatc
tccatccgattccctcgctgcacccgaatccgagatgataaggactggaaatctgccact
aaccttcctcaactcaaggaactgtaccagctgtccaaggagaaagcagacttcactgta
atggctggagatgaagggagctccactacagggggtagcagtgaagagaataagggtccc
tcggggtcttctgtgtcccacaaggctcccagcgcctcccccaacaagccttatgccagt
accaagaaagcagaagggaagctgagtaactccaacagcaaaggcggcaacatgctgact
gcaaagccttcccctgtgacggtgggagagaagctggccatgaagtcttctccagtgaaa
gtgggggagaagcggaaagccgctgatgagaccctgtgccaaacaaaggtgctacctgac
atcttcactggggtgcggctgtacttgccgccctccacaccagacttcagccgtctcaga
cgctactttgtggcattcgacggggacctggtacaggaatttgatatggcctcagccaca
catgtgctgtgtagcagggacaagaacccttcagcccagcaggtctccccagagtggatt
tgggcatgtatccggaaacggagactggtagctccctgctag

DBGET integrated database retrieval system