KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030855Help
Entry
101030855         CDS       T04350                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101030855 (OGDHL)
  Amino acid metabolism
   00310 Lysine degradation
    101030855 (OGDHL)
   00380 Tryptophan metabolism
    101030855 (OGDHL)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     101030855 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MSQLRLLPSRLGAQAARLLAAHDVPVFGWRSRSSGPPAAFPSSKGGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFRKASEEASSGSAQPQPTSAPTRESRSVVSSRTKTSKLVEDHLAVQS
LIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQETDLDKEFQLPMTT
FIGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKR
TLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTVIDKSSEMGIENVILGMPHR
GRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVA
NPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSY
TTNGTVHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSVAAE
WRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTL
QEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGISED
VLTHIGSVASSVPLEGFKIHTGLSRILRGRADMIKNRTVDWALAEYMAFGSLLKEGIHVR
LSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGY
AMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSS
ARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKP
LIIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGVAAQAPEQVRRLIFCTGKVYYDLV
KERSSQGLEEKVAITRLEQISPFPFDLIKQEAEKYPRAELAWCQEEHKNMGYYDYISPRF
TTTLRRTRPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgaggctgctgccatcccgtcttggggcacaggccgcgaggctcctggct
gcacacgatgtcccggtgtttggctggcgcagcaggtcctctgggccaccagccgccttc
ccaagcagcaaaggtggaggtggctccagttacatggaggagatgtacttcgcctggctg
gaaaacccccagagtgtccacaagtcctgggacagcttcttccggaaagccagcgaagaa
gcctcttctggctctgctcagccacagcccacttctgctcccacccgtgagagcaggtct
gtagtctcaagccggaccaagaccagcaagttggtggaggaccacctggccgtgcagtcc
ctgatccgggcctaccagatccggggtcaccacgtggcccagctggaccccctgggcatt
ctggatgcagacctggactcctttgtgccctcagacttgatcacaaccattgataaactg
gccttctatgacctgcaggagactgacctcgacaaggagttccagctgcccatgaccacc
ttcatcgggggatctgaaaacactctctctctgcgggagatcattcggcgcctggagaac
acctactgccagcacattggcctggagttcatgttcatcaatgatgtggagcagtgtcag
tggatccggcagaagtttgagacccctggtgtgatgcagttctccagcgaggagaagcgg
acgctgctggcccggctggtgcgctccatgagatttgaagacttcctggcccggaagtgg
tcctcagagaagcgatttggcctggagggctgtgaagtgatgattcctgccctcaagacc
gtcatcgacaaatccagcgaaatgggaatcgagaatgtcatcttggggatgccacacagg
ggcaggctgaacgtgctggccaacgtgatccgcaaggacctggagcagatcttctgccag
tttgaccccaagctggaggcggcggacgagggctccggggatgtcaagtaccacctgggc
atgtaccatgagaggatcaaccgtgtcaccaacaggaacatcactctgtcactggttgcc
aacccctcccacctggaggcagtggaccctgtggtgcaggggaagacaaaagcagagcag
ttctaccgtggagacgcccagggcaagaaggtcatgtccatcctggttcacggggatgca
gcctttgccggccagggcgtggtgtatgagaccttccatctgagtgacctgccctcctat
acgaccaacggcaccgtgcacatcgtcgtcaataaccagattggcttcaccacggacccc
cggatggcccgctcctcaccataccccactgacgtggcccgggtggtcaatgcacccatc
ttccatgtgaatgccgatgacccagaggctgtgatgtacgtgtgcagcgtggctgccgag
tggagaaacaccttcaacaaagacgttgttgtggacctggtctgttaccgccggcgtggc
cacaacgagatggatgagcccatgttcacccagccactcatgtacaagcagatccacaga
caggtgcctgtgctgaagaagtatgcagacaagcttattgctgagggcacggtcaccctg
caggagtttgaggaagaaattgccaaatatgaccggatctgtgaggaagcttatggcagg
tccaaagataaaaagatcctgcatataaagcactggctggactccccctggcccggcttc
ttcaacgtagatggagagcccaagagcatgacgtgcccagccacaggcatctctgaggac
gtgctcacccacatcggcagcgtggccagctctgtgcccctggagggctttaagatacac
actggcctctctcgcattctgcggggccgggcggacatgatcaagaaccggacagtggac
tgggcgttggcagagtacatggcctttggctctctgctgaaggagggtatccacgtgcgg
ctcagtgggcaggatgtggagaggggcacattcagtcaccggcaccacgttctccatgac
caggaggttgaccgcaggacgtgcgtgcctatgaatcatctctggcccgaccaggccccg
tacactgtgtgcaacagctccctctcggagtacggagtcctgggctttgagctgggctat
gccatggccagccccaatgccctggtcctctgggaggcccagtttggggacttccacaac
acagcccagtgcatcatcgaccagttcatcagcactggccaggccaagtgggtgaggcat
aacggcattgtgctgctgctgccccatggcatggaaggcatgggcccggagcattcgtca
gcgaggcctgagaggttcctgcagatgagcaatgacgactcagatgcctaccctgcattc
accaaggacttcgaggtgagccagctctatgactgcaactggatcgtggtcaactgctcc
acgccggccaactacttccacgtgctgcgccggcagatcctgctgcccttccgcaagccg
ctgattatcttcacacctaaatctctgctgaggcacccagaggccaagtccagctttgac
caaatggtatccggaaccagcttccagcgggtgattcctgaagatggggtggcagcgcag
gcccctgagcaggtacggcggctcatcttctgcacgggaaaggtgtactacgacctggtg
aaggagcggagcagccagggtctggaggagaaggtggccatcacgcgcctggagcagatc
tctccgttccccttcgacctgatcaagcaggaggcagagaagtacccacgtgcggagctg
gcctggtgtcaggaggagcacaagaacatgggctactatgactacatcagcccacgcttc
acgaccaccctgaggcgcacgcggcccatatggtatgtcggccgggacccagcggctgca
ccagccacaggaaacaggaacactcacctggtgtcactgaagaagtttctggatactgcc
ttcaatctccaggcctttgagggcaagacattttag

DBGET integrated database retrieval system