KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036245Help
Entry
101036245         CDS       T04350                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X2
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04371  Apelin signaling pathway
sbq05034  Alcoholism
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101036245 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101036245 (HDAC4)
  Substance dependence
   05034 Alcoholism
    101036245 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    101036245 (HDAC4)
   05165 Human papillomavirus infection
    101036245 (HDAC4)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101036245 (HDAC4)
Chromosome [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101036245 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101036245
NCBI-ProteinID: XP_003936809
LinkDB All DBs
Position
Unknown
AA seq 1083 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCLSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGNVSAENGIAPAVPSIPVETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQDAERLALPALQQRLSLFPGTHLTPYLSTSPLERDGGTAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGKEAHTPGGVQVKQEPIESDDEEAEAPQEVEPGQRQPSEQELLFRQQALLLEQQR
IHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSAQESPAKPRFTTGLVYDTL
MLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTL
LYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVEL
VFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDV
HHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPP
MGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLM
GLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVM
EIHSKYWRCLQRAASTAGRSLIEAQTCENDEAETVTAMASLSVGVKPAEKRPDEEPMEEE
PPL
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggacgtggccacggcgctgcctctg
caggtggcgccctcggcagtgcccatggacctgcgtctggaccaccagttctctctgcct
gtggcggagcctgccctgcgggagcagcagctacagcaggagctcctggcactcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccgccagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggagcaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttgcaagagtttgtcctc
aataaaaagaaggcgctggcgcaccggaacctgaaccactgcctctctagcgaccctcgc
tactggtacgggaaaacgcagcacagttccctcgatcagagttctccaccccagagcgga
gtgtcggcctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattgcggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccttgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactctgcctgcagcagcgcccccggctctgggccc
agctcacccaacaacagctccgggaacgtcagcgccgagaatgggatcgcacctgccgtc
cccagcatcccggtggagacgagtttggcgcaccgactcgtggcgcgagaaggctcggcc
gctccgcttcccctctacacgtcgccctccctgcccaacatcacgctgggcctgcctgcc
accggcccttccgccggtgcagcgggccagcaggacgccgagagactcgccctccctgcc
ctccagcagaggctctcccttttccctggcacccacctcactccctacctgagcacctcg
cccttggagcgggatggaggcacagcgcacagccctcttctgcagcacatggtcctactg
gagcagcccccggcacaagcgcccctcgtcacaggcctgggagctctgcccctccacgca
cagtccctggttggtgcggaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacataagcagcagttccagcagcag
caactgcacatgaacaagatcatccccaagccaagcgagccagcccggcagccagagagc
caccccgaggagacggaggaggaactccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggaaggaggcgcacacaccgggcggcgtgcaggtgaagcaggag
cccatcgagagcgacgacgaagaggcagaggccccgcaggaggtggagccaggccagcgc
cagcccagtgagcaggagctgcttttcagacagcaagctctcctgctggagcagcagcgg
atccaccagctgaggaactaccaggcgtccatggaggccgctggcatccccgtgtccttc
ggcggccaccggcctctgtcccgggcacagtcgtcgccggcgtccgccaccttccccgtg
tctgcgcaagagtcccccgccaagccgaggttcacgacaggcctcgtgtacgacacgctg
atgctgaagcaccagtgcacctgcgggagcagtagcagccaccccgagcatgccgggagg
atccagagcatctggtcccgcctgcaggagactggcctccgaggcaaatgcgagtgcatc
cgcggacgcaaggccaccctggaggagctgcagacggtgcactcggaggcccacaccctc
ctgtacggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggctcg
ctggcctccgtgttcgtccggctcccctgcggtggtgttggggtggacagtgacaccatc
tggaatgaggtgcactcagcaggggccgcccgcctggccgtgggctgcgtagtggagctg
gtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtccgcccccctgga
caccacgcggaggagagcacgcccatgggtttttgctacttcaactccgtggccgtggca
gccaagcttctgcagcaaaggttgagcgtgagcaagatcctcatcgtggactgggacgtg
caccacggaaacgggacccagcaggctttctacagtgaccccagcgtcctgtacgtgtcc
cttcaccgctacgatgatgggaacttcttcccaggcagcggcgctcctgacgaggtgggc
acagggccaggcgtgggtttcaacgtcaacatggctttcactggcggcctggaccccccc
atgggagatgccgagtacttggcggccttcagaacggtggtcatgccgatcgccagcgag
tttgccccggacgtggtgctggtgtcatcgggcttcgacgccgtggagggccaccccacg
cctctcgggggctacaacctctccgccagatgtttcgggtacctgacgaagcagctaatg
ggcctggctggtggccggattgtcctggccctcgagggaggccacgacctgaccgccatc
tgcgacgcctccgaagcatgtgtttctgctctgctgggaaatgagcttgatcccctccca
gaaaaggttttacagcaaagacccaatgccaacgctgtccgctccatggagaaggtcatg
gaaatccacagcaagtactggcgctgcctgcaacgtgcagcctctacggcggggcgctcc
ctgatcgaggctcagacctgtgagaacgacgaagccgagacggtcaccgccatggcctcg
ctgtctgtgggcgtgaagcccgccgaaaagagaccagacgaggagcccatggaagaggag
ccgcccctgtag

DBGET integrated database retrieval system