KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040690Help
Entry
101040690         CDS       T04350                                 

Gene name
SETD8
Definition
(RefSeq) N-lysine methyltransferase SETD8
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101040690 (SETD8)
Enzymes [BR:sbq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101040690 (SETD8)
Chromosome [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101040690 (SETD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MSGSGQARREPEVPDPEGQSAEGRAAAPIRSSSWSPAEQLAAVVATFFESWVSREIPGGD
RVGPWLEENLFIGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREE
KRNAGNAVRSAMKSEEQKIKDARRGPLASFPNQKSEAAEPPKTPPSSCDSANAAVSKQAL
KKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEG
MKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQY
LSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYG
DRSKASIEAHPWLKH
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttccggtcaagcccgcagggaaccggaagtcccagatccggaagggcagtct
gcagaggggcgggcggcggcgccaatccggtcgagcagctggagtccggcggagcagttg
gctgcagttgttgcaacttttttcgaaagctgggtttcccgggagatcccaggcggtgac
agagtgggaccatggctagaggagaatctatttatcgggcagtcgaagatctattcctac
atgagcccgaacaaatgctctggaatgcgtttcccccttcaggaagagaactcagttaca
catcacgaagtcaaatgccaggggaaaccattagccggaatctacaggaaacgagaagag
aaaagaaatgctgggaacgcagtacggagcgccatgaagtccgaggaacagaagatcaaa
gatgccaggagaggtcccctggcatcttttccaaaccaaaaatctgaagcagcagaacct
ccaaaaactccaccctcgtcttgtgattccgccaatgcagccgtctccaagcaagccctg
aaaaagcccatcaagggcaaacaggccccccgaaaaaaagctcaaggaaaaacgcaacag
aatcgcaaacttacggatttctaccctgtccgaaggagctccaggaagagcaaggctgaa
ctgcagtctgaagaaaggaaaagaatagatgaattgattgaaagtgggaaggaagaagga
atgaagattgacctcatcgatggcaaaggcaggggtgtgattgccaccaagcagttctcc
cggggtgactttgtggtggaataccatggggacctcattgagatcaccgacgccaagaag
cgggaggctctgtacgcacaggacccttccacgggctgctacatgtactattttcagtat
ctgagcaaaacctactgcgtggatgcaactagagagacaaatcgcctaggaagactgatc
aatcacagcaaatgtgggaactgccaaaccaaactgcacgacatcgacggtgtacctcac
ctcatcctcatcgcctcccgagacatcgcggctggggaggagcttctgtatgactatggg
gaccgaagcaaggcttccattgaagcccacccgtggctgaagcattaa

DBGET integrated database retrieval system