KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040990Help
Entry
101040990         CDS       T04350                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8 isoform X1
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05034  Alcoholism
sbq05165  Human papillomavirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101040990 (HDAC8)
  Substance dependence
   05034 Alcoholism
    101040990 (HDAC8)
  Infectious diseases
   05165 Human papillomavirus infection
    101040990 (HDAC8)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101040990 (HDAC8)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101040990 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DNase-RNase
Motif
Other DBs
NCBI-GeneID: 101040990
NCBI-ProteinID: XP_010330690
LinkDB All DBs
Position
Unknown
AA seq 383 aa AA seqDB search
MEEPEEPEDSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRVVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATI
TAAQCLIDGMSKVAINWSGGWHHAKNNLFSYRDEASGFCYLNDAVLGILRLRRKFERILY
VDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDG
IQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQW
QLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRP
DRNEPHRIQQILNYIKGNLKHVV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagagccggaggaaccggaggatagtgggcagtcgctggtcccggtttatatctat
agtcccgagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatg
gtacattctttgattgaagcatacgcactgcataagcaaatgagggtagttaagcccaaa
gtggcctccatggaggagatggccaccttccacactgatgcttatctgcagcatctccag
aaggtcagccaagagggcgatgatgatcatccggactccatagaatatgggctaggttat
gactgcccagccactgaagggatatttgactatgcagcagctgtaggaggagctacgatc
acagctgcccagtgcctgattgatggaatgtccaaagtagcaattaactggtctggaggg
tggcatcatgcaaagaacaacttgttttcttacagagatgaagcatctggtttttgttat
ctcaatgatgctgtcctgggaatattacgattgcgacggaaatttgagcgtattctctac
gtggatttggatctgcaccatggagatggtgtagaagacgccttcagtttcacctccaaa
gtcatgactgtgtccttgcacaaattctccccgggatttttcccaggaacaggtgatgtg
tctgatgttggcctggggaagggacggtactacagtgtaaatgtgcccattcaggatggc
atacaagatgaaaaatattaccagatctgtgaaagtgtactaaaggaagtataccaagcc
tttaatcccaaagcagtggtcttacagctgggagctgacacaatagctggggatcccatg
tgctcctttaacatgactccagtgggaattggcaagtgtcttaagtacgtccttcaatgg
caattggcaacactcattttgggaggaggaggctataaccttgccaacacggctcgatgc
tggacatacttgaccggggtcatcctagggaaaacactatcctctgagatcccagatcat
gagtttttcacagcatatggtcctgattatgtgctggaaatcacaccaagctgccggcca
gaccgcaatgagccccaccgaatccagcaaatcctcaactacatcaaagggaatctgaag
catgtggtctaa

DBGET integrated database retrieval system