KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043458Help
Entry
101043458         CDS       T04350                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101043458 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101043458 (CDC23)
   04114 Oocyte meiosis
    101043458 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101043458 (CDC23)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    101043458 (CDC23)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     101043458 (CDC23)
Chromosome [BR:sbq03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    101043458 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 597 aa AA seqDB search
MAAGASMVQVAVTAAVAPVLSTNSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPVTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETSTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggtgcctccatggtccaggtggctgtgacggcagcagtggcacctgtcctg
tccacgaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggtctgactcgggagcggggcctactgcacagtagcaaatggtcggcggagttggccttc
tctctccccgcattgccactggccgagctgcaaccgcctccgcctgttacagaggaggat
gctcaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tcccgatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggtccc
ttggaaaaaggacaagtgaaaaatgaagctcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgggaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaggctactcatgttttgccc
ttgcactggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacatgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaatta
aatcctcggtatctgggtgcctggacactgatgggacatgagtacatggagatgaagaac
acatctgctgctatccaggcttatagacatgccattgaagtcaacaagcgggactacaga
gcttggtatggccttgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgagcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gagtgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgctttccgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgccttcaat
gatacccgagaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagacttccaccactgaggtgcctgctccttttttcctgcctgcttcactgtctgctaat
aacacccccacacgcagagtttctccactcaacttgtcttctgtcacaccatag

DBGET integrated database retrieval system