KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045208Help
Entry
101045208         CDS       T04350                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    101045208 (B3GALT4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     101045208 (B3GALT4)
Glycosyltransferases [BR:sbq01003]
 Glycan extension
  Glycolipid
   101045208 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 383 aa AA seqDB search
MQLKLFRRLLLASLLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACGGPGAPPFLLILVCTAPGNLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQNPM
WGSHGNDLASESLAQGDILQAAFQDSYRNLTLKTLTGLNWADKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWEQWETSTESEREAEVGNEEQEGGQVLHSEEVPLLYLGRVHWRVN
PSRTPGGRHHVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPPLPLEDVFVG
VSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTA
PFCSWFQGVLGILRCRIIAWLHS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagctcttccggcgcctgctccttgcatctctgctgctggtgatcgtctgg
accctctttgggccttcggggttgggggaggagctgctgagcctctcactagcctccctg
ctcccagcccccgcctcacccgggccgcccctggccctgccccgcctcttgatccccaac
caggaagcttgcggtggtcccggtgcccctcccttcctgctcatcctagtgtgcacggct
ccggggaacctgaaccagagaaacgccattcgggcctcgtggggcgggctgcgtgaggct
cgagggctcagggtacagacgctgttcctgctgggagagccgaacgcgcagaaccccatg
tggggctcccacgggaacgacctggcctcggagtcattggcccagggagacatcttacag
gctgccttccaggactcctaccgcaacctcacactcaaaaccctcactgggctgaactgg
gctgataaacactgccccatggcccgatacgtcctcaagacagacgatgatgtgtatgtc
aacgtccccgaactggtatcagagctggtcttgcgagggggccgttgggagcaatgggag
acaagcacggaatctgagagagaggctgaggttgggaatgaagagcaggaaggtggccag
gtcttgcacagcgaggaagtgcctcttctgtacctgggccgcgtgcactggcgggtgaac
ccctctcggacaccagggggcagacaccatgtttcggaggagcagtggcctcacacctgg
ggcccctttccaccctatgcctcaggcacaggatacgtgctgtcagcgtctgctgtgcag
ctcattctgaaggtggccagccgggcaccccctctcccattagaggatgtctttgtgggg
gtaagtgcccgacgaggaggccttgccccaacacagtgtgtcaagctggctggtgccacc
cactaccccctggaccggtgctgctatgggaaattcctgctgacgtcccacaggctggac
ccctggaagatgcaggaagcctggaagctggtgggtggctctgatggagaaaggactgcg
cccttttgctcctggttccagggagtcctgggcatcctgcggtgtcggataatagcctgg
cttcacagctga

DBGET integrated database retrieval system