KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047215Help
Entry
101047215         CDS       T04350                                 

Gene name
TGM1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101047215 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 816 aa AA seqDB search
MMDGPRSDVGRWGGNPWQPPTTPSPEPEPEPERRSRRGGRSFWARCCGCCSCRNAADDDW
GPEPSDSRDRGSRSGTRRPGSRGSDSRRPISWGSGVNAAGDGTIREGMLVVTGVDLMSSR
SDQNRREHHTDEYEYDELIVRRGQPFHVLLVLSRTYESSDRITLELLIGNNPEVGKGTHV
IIPVDKGGSGGWKAQVVKANGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRN
EIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDAC
LYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEI
LLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENM
KPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIK
NGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMREDIT
YLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLNVSVMLT
NQSSSRRTVKLHLYLSVTYYTGVTGTIFKETKKEVALAPGASDRVTMPVAYKEYRPHLVD
QGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTL
TNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGV
IQVDVAPASGDRGLFSDAGGDSHLGETIPMASRGGA
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgggccacgttccgacgtgggccgttggggtgggaacccctggcagccccct
accacgccttcgccagagccagagccagagccagagagacgctctcgcagaggaggccgt
tccttctgggctcgctgttgtggctgctgttcatgccgaaatgcagcagatgatgactgg
ggacctgaaccctctgactccagggatcgagggtccaggtctgggacccgaaggcctggc
tcccggggctcagactcccgccggcctatctcctggggcagtggtgtcaatgcagctgga
gatggcaccatccgagaggggatgctagtagtgaccggtgtggacttgatgagctcgcgc
tcagaccagaaccgccgagagcaccacacagacgagtatgagtacgacgagctgatagtg
cgccgcgggcagcctttccatgtgctcctcgtcctgtcccggacctatgaatcctctgat
cgcatcacccttgagttactcatcggaaacaaccctgaggtgggcaagggcacacatgtg
atcatcccagtggacaaggggggcagtggcggctggaaggcccaggtggtgaaggccaat
ggacagaatctgaacctgcgggtccacacctctcccaacgccatcatcggcaagtttcag
ttcacagtccgcacacaatcagacgctggggagttccagttgccctttgacccccgcaac
gagatctacatcctcttcaacccctggtgcccagaggacattgtgtacgtggaccatgag
gattggcggcaggagtatgtgcttaatgagtctgggagaatttactacgggaccgaagca
cagattggcgagcggacctggaactatggccagtttgaccatggggtgctggatgcctgc
ttgtacatcctggaccggcgggggatgccatatggaggccgtggagacccagtcagtgtc
tcccgggtcatctctgccatggtgaactccctggatgacaatggagtcctgattgggaac
tggtctggtgattactctcgaggcaccaacccatcagcctgggtgggcagcgtggagatc
ctgcttagctacctacgcaccggctattccgtcccctatggccagtgctgggtctttgct
ggcgtgaccactacagtgctgcgctgcctgggtctggccacccgtactgtcaccaacttc
aactccgcccatgacacagacacatcacttaccatggacatctacttcgatgagaatatg
aagcccctggagcacctgaaccatgattctgtctggaacttccatgtatggaatgactgc
tggatgaagaggcccgatctgccctcgggctttgacgggtggcaggtggtggatgccacg
ccccaggagactagcagtggcatcttctgctgtggcccctgttccgtggagtccatcaag
aatggcctggtctacatgaagtatgacacacctttcatttttgctgaggtgaatagtgac
aaggtgtactggcagcggcaggacgatggcagcttcaagattgtgtatgtggaggagaag
gccattggcacactcattgtcaccaaggccattggctccaacatgcgggaggacatcacc
tacctctataagcatccagaaggctcagacgcggagcggaaggcagtagagacagcagca
gcccacggcagcaaacccaacgtgtacgccaaccggggctcagctgaggatgtggccatg
caggtggaggcacaggacgcagtgatggggcaggatctgaacgtctctgtgatgctgacc
aatcaaagcagcagtcgtcgcacggtgaaactgcacctctacctctcggtcacctactac
actggtgtcactgggactatcttcaaggagacaaagaaggaagtggcactggcaccgggg
gcctcggaccgtgtgaccatgcccgtggcctacaaggaataccggccccaccttgtggac
cagggggccatgctgctcaacgtctcaggccatgtcaaggagagcgggcaggtgctggcc
aagcagcacaccttccgtctgcgcaccccagatctctccctcacgttactgggagcagca
gtggttggccaggagtgtgaagtacagattgtcttcaagaaccccctgcccgtcaccctc
accaatgtcgtcttccggcttgagggctccgggttacagagacccaagatcctcaacgtt
ggggacattgggggcaatgagacagtgacactacgccagacatttgtgcctgtgcggcca
ggcccccgccagctcattgccagcttggacagcccgcagctctcccaggtgcacggtgtt
atccaggtggatgtggccccagcctctggggacagaggcctcttctcagatgctggaggt
gacagtcacttgggagagaccatccctatggcatctcgaggtggagcttaa

DBGET integrated database retrieval system