KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048601Help
Entry
101048601         CDS       T04350                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101048601 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core RcnB
Motif
Other DBs
NCBI-GeneID: 101048601
NCBI-ProteinID: XP_003941090
UniProt: A0A2K6SJI8
LinkDB All DBs
Position
Unknown
AA seq 693 aa AA seqDB search
MAALELQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSRERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTVTINISSPASAPIGRYTMALQISSQ
GSVSSVNLGKFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIYAGSTNRIGMIGWNFGQ
FEEDILSICLSILDKSLNYRRDAATDVAHRNDPKYVGRVLSAMINSNDDNGVLAGNWSGN
YTGGRDPRNWNGSVEILKDWKKSGFRPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDMGSDSVWNFHVWNEGWFVRSDLGPSYSGWQVLDATPQER
SQGVFQCGPASVIGIREGDVNLNFDMPFIFAEVNADRITWLFDSNTRTQRKNSVDSRSIG
RYISTKAVGSNARMDVTDKYKYPEGSEEERGVFQKALGKLKPNASFGATSSTSSETEEQE
PSISGKFKVIGLLEVGKEVNLVLQLKNLSSDRKRVTVNMTAWTIVYNGTLVHEVWKDSAT
MSLDPEEETEYPVKISYAQYEKYLKSDNMIRITAVCKVPDEPEVVVERDVILDNPTLTLE
VLSEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFRAIKAMLSIDVAE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctagaactccagagtatcaactggcagacggccttcaaccggcaagcgcat
cacacagacaagttctccagccaggagctcatcttgcggagaggccaaaacttccaggtc
ttgatgatcatgaacaaaggccttggctctagagaaagactggagtttattgtctccaca
gggccttacccctcagagtcggccatgacgaaggctgtgtttccactctccaatggcagt
agcggaggctggagtgcagtgctccaggccagcaatggcaataccgtgaccatcaacatc
tccagtcccgccagcgcacccataggacggtacacaatggccctccagatctcctcccag
ggcagcgtctcctctgtgaaccttgggaagttcatactgctttttaatccctggctgaac
gtggatagtgtctttatgggtaaccatgctgagagagaagagtatgttcaggaagatgcc
ggcatcatctatgcgggaagcacaaaccgaattggcatgattggctggaactttggacag
tttgaagaagacattctcagcatctgcctctcaatcttggataagagtctgaattaccgc
cgtgatgctgctactgacgtggcccacagaaatgaccccaaatacgttggccgggtgcta
agtgccatgatcaatagcaacgatgacaatggtgtgcttgctggaaattggagcggcaat
tacacgggtggccgggaccccaggaactggaacggcagtgtggagatcctcaaggattgg
aaaaaatctggcttcaggccagtccgatatggccagtgctgggtctttgctgggaccctc
aacacagcgctgcggtctttggggattccttcccgggtgatcaccaacttcaactcagct
catgacacagaccgaaatctcagtgtggacgtgtactacgaccccatgggaaaccccctg
gacatgggtagtgatagcgtatggaatttccacgtctggaatgaaggctggtttgtgagg
tctgacctgggcccctcgtacagtggatggcaggtgttggacgctaccccgcaggaaagg
agccaaggagtgttccagtgcggccccgcttcggtcattggcattcgagagggtgacgtg
aacctgaacttcgacatgccctttatcttcgcggaggttaatgccgaccgcatcacttgg
ctgtttgatagcaacacccgcacacagaggaagaattctgtggacagtcgcagcattgga
aggtatatcagcaccaaggcggtgggcagcaatgctcgcatggatgtcacagacaagtac
aagtacccagaaggctctgaggaggaaagaggagtgttccaaaaggctttggggaaactt
aaacccaatgcatcatttggtgcaacgtcttcaaccagttcggaaacagaggaacaggag
cccagcatcagcgggaagttcaaggtcattggcttgctggaagtgggcaaagaagtcaac
ctggtcctacagctcaaaaacctgagcagcgataggaagagagtgacagtgaacatgaca
gcctggaccatcgtctacaatggcacgcttgtacatgaagtgtggaaggactctgccaca
atgtccctggaccctgaggaagagacagagtatcccgtgaagatctcgtacgcgcagtat
gagaagtacctgaagtcagacaacatgatccggatcacagccgtgtgcaaggtcccagat
gagcctgaggtggtggtggagcgggacgtcatcctggacaaccccaccctgaccctggag
gtactgagcgaggctcgtgtgcggaagcctgtcaatgtgcagatgctcttctccaatccc
ctggatgagccagtgcgggactgcgtgctgatggtggagggaagcggcctgctgttgggt
aacctgaagatcgacgtgccgaccctgcgtcccaaggagcggtcccgggtccgttttgag
atcctgcccacccggagtggcaccaagcagctgctcgccgacttctcctgcaataagttc
cgtgcaatcaaggccatgctgtccatcgacgtagcggaatga

DBGET integrated database retrieval system