KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049489Help
Entry
101049489         CDS       T04350                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101049489 (SDHA)
  Energy metabolism
   00190 Oxidative phosphorylation
    101049489 (SDHA)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101049489 (SDHA)
   05012 Parkinson's disease
    101049489 (SDHA)
   05016 Huntington's disease
    101049489 (SDHA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101049489 (SDHA)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101049489 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 685 aa AA seqDB search
MHGSTWVHTEVNSSQGRIRILSPQHLFLQDTNALDLCLLCLQWPVVSPAGTRGFHFAVDG
NKRASAKVSESISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSH
TVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMP
FSRTQDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEY
FALDLLMENEECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAM
VTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLAS
RDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEP
IPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLD
LVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSM
QNHAAVFRVGSVLQEGCEKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTI
YGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTL
EYRPVIDKTLNEADCTTVPPAIRSY
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggagcacctgggtacatacagaggtgaacagttcgcaaggcagaattcgaatt
ctgtccccacagcatttgttccttcaggacactaacgctctggatctgtgtcttctgtgt
ctccagtggccagtggtgtcaccagcagggacccgaggctttcacttcgctgttgatggg
aacaagagggcatctgctaaagtctcagaatccatttctgctcagtatccagtagtggat
catgaatttgatgcagtggtggtgggcgctggaggggcaggcttgcgagctgcgtttggc
ctttctgaggcagggtttaatacggcatgtgttaccaagctgtttcctaccaggtcacac
actgttgcagcccagggaggaatcaatgctgctctggggaacatggaggaggacaactgg
aggtggcatttctacgacaccgtgaaaggctccgactggctgggggaccaggatgccatc
cactacatgacagagcaggcccctgccgccgtggtcgagctagaaaattatggcatgccg
tttagcagaacccaagatgggaagatttatcagcgtgcgtttggtggacagagcctcaag
tttggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggacaggccactcg
ctattgcacaccttgtatggaaggtctctgcgatacgataccagctactttgtggagtat
tttgccttggatctcctgatggagaatgaagagtgccgtggtgtgattgcactgtgcata
gaagatgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctac
gggcgcacctacttcagctgcacgtccgcccacaccagcaccggtgatggcacggccatg
gtcaccagggcaggccttccttgccaagacctggagttcgtccagttccaccccacaggc
atatatggtgctggttgtctcatcacggaaggatgtcgtggagagggaggcattctcatt
aacagtcagggcgaaaggtttatggagcgatacgcccccgtcgcaaaggacctggcgtcc
agagacgtggtgtctcggtccatgactctggagatccgcgaaggaagaggctgtggccct
gagaaagatcacgtctacctgcagctgcaccacctgcctccagagcagctggccacgcgc
ctgcctggcatttcagagacagccatgatctttgccggcgtggacgtcacgaaggagccg
atccctgtcctccccaccgtgcactataacatgggcggcattcccaccaactacaagggg
caggtcctgaggcacgtgaatggccaggatcagatcgtgcccggcctgtatgcctgtggg
gaggccgcctgcgcctcagtccatggtgccaaccgccttggggcaaactcactcttggac
ctggttgtctttggccgggcctgtgccctgagcatcgaagagtcatgcaggcctggagat
aaagtccctccaattaaaccaaatgctggggaagagtctgtcatgaaccttgacaagctg
agatttgctgatggaagcataagaacgtcggaactgcgactcagcatgcagaagtccatg
cagaatcatgctgccgtgttccgtgtgggaagcgtgctgcaagaaggctgtgagaaaatc
agcaaactctatggagacctgaagcacctgaagacgttcgacaggggaatggtctggaac
acggacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatc
tacggagcggaggcacggaaggagtcgcggggtgcgcacgccagagaagactacaaggtg
cggattgatgagtatgattactccaagcccatccaggggcaacagaagaagccctttgag
gagcactggaggaagcacaccctgtcctatgtggacgtgggcactgggaaggtcactctg
gaatatagacctgtaatcgacaaaactttgaacgaggctgactgcaccaccgtcccccca
gccatccgctcctactga

DBGET integrated database retrieval system