KEGG   Salmonella bongori serovar 48 z41 --: N643_10160Help
Entry
N643_10160        CDS       T03249                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00564  Glycerophospholipid metabolism
sbv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    N643_10160 (glpA)
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     N643_10160 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 Lycopene_cycl FtsA Pyr_redox_3 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AID25383
LinkDB All DBs
Position
2163684..2165312
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDDLTFQATFIRACETAGIRAEA
IDPQQARLIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATICGVHVRNSLTGETQTFHAPVVVNAAGIWGQRIAEYADLNIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTAEEVDILLREGEKLAP
IMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLEGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTAGTPLPGSKESTERTLKRIISLPAPLRGSAVYRHGDRTP
EWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgtgactcgcaagcaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgtgactgcgcgttacgcggtttacgcgtcatcctggtggaacggcat
gatattgcgaccggcgcgaccgggcgtaatcacgggctgctgcacagtggcgctcgttat
gcagttactgacgcggaatccgcccgcgagtgcattagcgaaaatcagatcctgaaacga
atcgcccgtcattgcgtcgaaccgacggatggtctgtttatcacattaccagaagacgat
cttacgtttcaggctacctttattcgcgcctgtgaaacggcaggcattcgcgctgaagct
atcgatccgcaacaggctcgccttattgagccttccgtcaaccctgcgcttatcggcgcg
gtaaaagtgccggacggcacggtggaccctttccgcctcaccgccgccaatatgctggac
gccagagaacatggcgccatcgtgttgacggcgcatgaagtgaccggacttattcgcgaa
ggcgcaacaatctgtggcgttcatgtgcgcaactctctcactggcgaaacccagacgttc
catgcgccagtggtggttaatgcggctggtatctggggtcaacggattgctgaatatgcc
gatttaaacattcgcatgttcccggcaaaagggtcgttgttgatcatggatcaccgaatc
aatcagcatgtgattaaccgctgccggaagccgtcggatgccgacattctggtgcccggc
gatacaatttcgctgattggcaccacgtctacccatattgattataacgagatagacagc
aaccgcgtcaccgccgaggaagtcgatatcctgttacgtgaaggggaaaaactggccccc
atcatggctaagacgcgtattctgcgtgcttattccggcgtccgcccgctggtagccagt
gacgacgatcccagcggccgtaacgtcagccgcggtattgtcctgttcgaccacgccgag
cgcgatggacttgaaggcttcattaccattaccggcgggaagctaatgacttatcgcctg
atggcagaatgggctaccgacgctgtatgccgtaagctgggcaatacccgcccctgcacc
acggcgggtacgccgctgcctggctcaaaagagtctacagaacgtacactgaaacgtatt
atctcgcttcccgcgccgctacgcggatcggcggtttatcgacacggcgatcgcacgccg
gaatggctaagcgaaggccgccagcatcgtagtctggtctgtgaatgtgaggccgtcacg
gcgggtgaagtacagtatgccgtcgaaaacttaactgtgaatagcctgctggatctgcgc
cgtcgcactcgcgtaggcatgggcacttgccagggcgaactgtgcgcctgccgcgccgcc
gggctattgcagcgttttaatgtgacgaccgccgcgcaatctattacacaactctctgaa
ttcctgaatgaacgctggaagggcgtgcagccgatcgcctggggagacgcgctgcgcgaa
agtgaattcacgcgctgggtttaccagggattatgcggtctggagaaggagcatcaggat
gaaatttga

DBGET integrated database retrieval system