KEGG   Salmonella bongori N268-08: A464_1466Help
Entry
A464_1466         CDS       T02733                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sbz  Salmonella bongori N268-08
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A464_1466
Enzymes [BR:sbz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A464_1466
Transporters [BR:sbz02000]
 Other Transporters
  Pores ion channels [TC:1]
   A464_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1458858..1459463)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLEGVDLAKKRLENGDDYLALNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPISSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
LKPAVRAGLEKKLQYVNEALADDQWICGQRFTIADAYLFTVLRWAYGVKLPLDGFTHIES
YMKRAAERPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgttctcttgcttcccacattacccttcgcgag
attggcaaagacttcacgcttgagggtgtcgatctcgcgaaaaagcgtctggaaaatggc
gatgattaccttgcgctaaacccgaaaggacaggttcctgctctgcttttggatgacggc
acattattgactgaaggggtcgccattatgcagtatcttgcagacagcgttcccgaccgc
cagcttctggcccccataagcagtcttgcgcgttatcatacgctggagtggctaaactat
attgcaacggaactgcataaagggtttacgccgctgtttcgccctgacacacccgaaacg
cttaagcctgccgtccgtgccggactggaaaagaaattacaatacgttaatgaggcgctt
gcagacgatcaatggatttgcggtcaacgttttactatcgcagacgcttatctgtttacc
gttttgcggtgggcatatggggtaaaactgcctcttgacgggttcacgcatattgagagt
tatatgaagcgcgctgcggaaagaccggctgttgcagccgcgcttaaagcggaaggatta
aattaa

DBGET integrated database retrieval system