KEGG   Streptomyces scabiei: SCAB_1551Help
Entry
SCAB_1551         CDS       T01187                                 

Definition
(GenBank) putative adenylation protein
Organism
scb  Streptomyces scabiei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(174285..176006)
Genome map
AA seq 573 aa AA seqDB search
MTVTDPFPSVWHALLAEAERGSDGSALTLIPEPGTEDTLRYDALVGNAARCAAALAERGV
GHGDRVLLCLPTGVEFLTAFFGTQLLGAVPTAIAVPIRFGGAAGFAGQMKELVAYLRPAA
VVTTEAVIEALPELAGATLLDGAALYARAIASDAPSHPIRRPDLDDTALIQCTSGSTGRP
KGVMISHAALAANCRQLTDATGWTRADTTVSWAPLYHDMGLITGVLCPVYVGGGTVLMPP
TRFLRAPGEWLRHISTYRGAVAAAPNFAYGYVTSRVRDEELDGVDLSCWRMAFCGAEPVQ
PATARRFVERFSRWGLPPRAFTPGYGMAEATLVITVKRPDAPFRYDSIDRETAVTGGRVV
DVDPQSPTAVQVVDCGVPVADAEVRVVDDNGDPLGENRIGHVQFRSRSRTTGYFDLPEES
AAATDATDWWRTGDIGYLRDGSLRITSRAKDLIIMRGANYFPSDFEQAAETVPGVRLGAV
IAVGHRPEDADSEELHLIVETELDGAQHEALRQAVRAAVSSRTGVTPAAIHLVPKRSIPK
TTSGKLQRAKARHLFVEGAPAAPIRGASGAAPR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgacagacccgttcccgagcgtgtggcacgccctgctggcagaggcggaacgc
ggctccgacggatcggcgctcacgctgatcccggagcccggcaccgaggacaccctgcgc
tacgacgccctggtcggcaacgccgcccggtgtgcggccgccctcgccgagcggggagtc
ggacatggcgaccgggtgctgctctgcctgcccacgggcgtggagttcctcaccgccttc
ttcggcacccagctgctcggcgccgtaccgacggcgatcgcggtaccgatacggttcggc
ggtgccgccgggttcgcgggccagatgaaggaactggtggcgtatctgcggcccgccgcg
gtcgtcaccacggaagccgtcatcgaggccctgcccgagctcgcgggcgcgaccctgctc
gacggtgccgcactgtacgcgcgggccatcgccagtgacgctccctcgcacccgatccga
cggccggaccttgacgacacggcgctgatccagtgcacctcgggctcgacaggcaggccc
aagggcgtcatgatctcgcacgccgccctggcggccaactgcaggcagctgaccgacgcc
accgggtggacgcgcgcggacacgacggtcagctgggcgccgctgtaccacgacatgggg
ctgatcaccggcgtcctgtgccccgtctatgtcggcggcggcacggtgctgatgcccccc
acccgcttcctgcgcgccccgggagagtggctgcggcacatcagcacctaccgcggtgcc
gtcgccgccgcgccgaacttcgcctacggctacgtcacctcgcgggtgcgcgacgaggag
ctggacggagtggacctgtcctgctggcgcatggcgttctgcggcgcggaacccgtccag
cccgccaccgcccggcgcttcgtcgagcggttctcccggtggggtctgccgccacgggcg
ttcacaccgggctacgggatggccgaggccaccctggtcatcaccgtcaagcggcccgac
gcgccgttccggtacgactccatcgaccgggagaccgccgtcaccgggggacgggtggtc
gacgtcgacccgcagagcccgaccgcggtgcaggtggtcgactgcggcgtgcccgtggcc
gacgcggaggtccgtgtcgtggacgacaacggcgaccccctgggggagaaccggatcgga
cacgtccagttccgcagtcgctcgcgcacgaccgggtacttcgacctgccggaggagtcc
gccgccgcgacggacgcgacggactggtggcggaccggcgacatcggctacctgcgcgac
ggcagcctgcggatcaccagccgggccaaggacctgatcatcatgcggggggccaactac
ttcccctcggacttcgagcaggccgccgagaccgtgcccggggtgcgcctgggcgccgtg
atcgcggtggggcaccggcccgaggacgccgactccgaggaactccatctgatcgtcgag
accgaactggacggcgcgcagcacgaggccctgcgccaggccgtgcgggccgcggtgagc
tcgcggaccggtgtgaccccggccgcgatccatctcgtgccgaagcggagcatccccaag
acgaccagcggcaagcttcagcgggccaaggcccggcacctgttcgtcgagggcgcgccc
gccgccccgatccgaggcgcgagcggggcagcgccccggtga

DBGET integrated database retrieval system