KEGG   Streptomyces scabiei: SCAB_42121Help
Entry
SCAB_42121        CDS       T01187                                 

Definition
(GenBank) putative aminotransferase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
scb  Streptomyces scabiei
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCAB_42121
Enzymes [BR:scb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SCAB_42121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4744161..4745360)
Genome map
AA seq 399 aa AA seqDB search
MLSGLRSRFVLDDAVYLDGNSLGALPASVPGRLTDVVHREWGEMRIRSWDESGWWTAPER
IGDRIAPLVGAAPGQIVVGDSTSVNVFKAVVAAVRMAEEDSASAGGRRDEILVDATTFPT
DGYMAESAARMTGRTLRPVTPAEVPAALSDRTAAVLLNHVDYRTGRLHDLPALTAAVHEA
GAYAVWDLCHSAGALPVDLDEHGVDLAIGCTYKYLNGGPGSPAYLYVRRDLQPRFDSPLP
GWTSHAAPFAMRPAYEAAAGAPRGRVGTPDILSMLALEAALDVWYEGGDGGAAGAGATIA
AVRAKSLALTDFFLRCVAAYVPEGRVESLTPVAHAERGSQVALRCDDAGDVMKRLIHRGV
IGDFRHPDVLRFGFTPLYVTFADVERAARVLAETLGEAG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtccggcctgcgttcccgcttcgtcctcgacgacgccgtctacctcgacggcaat
tcgctcggcgcgctgccggcctcggtccccggacggctcacggacgtcgtccaccgcgag
tggggcgagatgcgcatccgctcctgggacgagagcggctggtggactgcgcccgagcgg
atcggcgaccggatagccccgctggtcggcgcggccccgggccagatcgtggtcggcgac
tccacgagtgtcaacgtcttcaaggcggtcgtggcggcggtacggatggcggaggaggac
tccgcctccgccggcggccgtcgtgacgagatcctggtcgacgcgacgacgttccccacg
gacggctacatggccgagtcggcggcccggatgaccggccgtaccctgcgcccggtgacc
ccggcggaggtcccggccgccctgagcgaccggacggctgccgtcctgctcaaccatgtc
gactaccgcaccggccgcctccacgacctccccgccctgacggcggcggtccacgaggcc
ggcgcctacgccgtctgggacctctgccacagcgcgggcgccctgcccgtggacctggac
gaacacggggtcgacctcgcgatcggctgcacctacaagtacctgaacggcggccccggc
tccccggcctacctctacgtccgcagggacctgcagccccgcttcgactcgcccctcccc
ggctggacctcgcacgccgcccccttcgccatgcgcccggcctacgaggccgcggcgggg
gcaccccggggccgggtgggcacgcccgacatcctgtcgatgctggccctggaggcggcg
ctggacgtctggtacgagggcggcgacggcggtgccgccggggccggggcgacgatcgcc
gcggtccgcgccaagtccctcgccctgacggacttcttcctgcgctgcgtggcggcgtac
gtccccgagggccgggtcgagtccctcaccccggtcgcccacgcggagcgcggcagccag
gtcgccctgcgctgcgacgacgccggcgacgtcatgaaacgcctcatccaccggggtgtc
atcggcgacttccgccaccccgacgtcctccgcttcggcttcaccccgctctacgtcacc
ttcgcggacgtggaacgggcggcgcgcgtgctggcggagacgctgggggaggcggggtag

DBGET integrated database retrieval system