KEGG   Saccharomyces cerevisiae (budding yeast): YLR174WHelp
Entry
YLR174W           CDS       T00005                                 

Gene name
IDP2
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) IDP2
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YLR174W (IDP2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YLR174W (IDP2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    YLR174W (IDP2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YLR174W (IDP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
LinkDB All DBs
Position
XII:504591..505829
Genome map
AA seq 412 aa AA seqDB search
MTKIKVANPIVEMDGDEQTRIIWHLIRDKLVLPYLDVDLKYYDLSVEYRDQTNDQVTVDS
ATATLKYGVAVKCATITPDEARVEEFHLKKMWKSPNGTIRNILGGTVFREPIIIPRIPRL
VPQWEKPIIIGRHAFGDQYKATDVIVPEEGELRLVYKSKSGTHDVDLKVFDYPEHGGVAM
MMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFE
SLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDG
KTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILE
SATVNTVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRLKKEFEAAAL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagattaaggtagctaaccccattgtggaaatggacggcgatgagcaaacaaga
ataatctggcatttaatcagggacaagttagtcttgccctatcttgacgttgatttgaag
tactacgatctttccgtggagtatcgtgaccagactaatgatcaagtaactgtggattct
gccaccgcgactttaaagtatggagtagctgtcaaatgcgcgactattacacccgatgag
gcaagggtcgaggaatttcatttgaaaaagatgtggaaatctccaaatggtactattaga
aacattttgggtggtacagtgttcagagaacctattattatccctagaattccaaggcta
gttcctcaatgggagaagcccatcatcattgggagacacgcattcggcgatcagtacaaa
gctaccgatgtaatagtccctgaagaaggcgagttgaggcttgtttataaatccaagagc
ggaactcatgatgtagatctgaaggtatttgactacccagaacatggtggggttgccatg
atgatgtacaacactacagattcgatcgaagggtttgcgaaggcctcctttgaattggcc
attgaaaggaagttaccattatattccactactaagaatactattttgaagaagtatgat
ggtaaattcaaagatgttttcgaagccatgtatgctagaagttataaagagaagtttgaa
tcccttggcatctggtacgagcaccgtttaattgatgatatggtggcccaaatgttgaaa
tctaaaggtggatacataattgccatgaaaaattacgacggtgacgtagaatcagatatt
gttgcacaaggatttggctccttggggttaatgacatctgtgttgattaccccggacggt
aaaacctttgaaagcgaagccgcccacggtacagtaacaagacattttagacagcatcag
caaggaaaggagacgtcaacaaattccattgcatcaattttcgcgtggactagaggtatt
attcaaaggggtaaacttgataatactccagatgtagttaagttcggccaaatattggaa
agcgctacggtaaatacagtgcaagaagatggaatcatgactaaagatttggcgctcatt
ctcggtaagtctgaaagatccgcttatgtcactaccgaggagttcattgacgcggtggaa
tctagattgaaaaaagagttcgaggcagctgcattgtaa

DBGET integrated database retrieval system