KEGG   Saccharomyces cerevisiae (budding yeast): YMR250WHelp
Entry
YMR250W           CDS       T00005                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase GAD1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    YMR250W (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YMR250W (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YMR250W (GAD1)
   00430 Taurine and hypotaurine metabolism
    YMR250W (GAD1)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     YMR250W (GAD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
LinkDB All DBs
Position
XIII:770801..772558
Genome map
AA seq 585 aa AA seqDB search
MLHRHGSKQKNFENIAGKVVHDLAGLQLLSNDVQKSAVQSGHQGSNNMRDTSSQGMANKY
SVPKKGLPADLSYQLIHNELTLDGNPHLNLASFVNTFTTDQARKLIDENLTKNLADNDEY
PQLIELTQRCISMLAQLWHANPDEEPIGCATTGSSEAIMLGGLAMKKRWEHRMKNAGKDA
SKPNIIMSSACQVALEKFTRYFEVECRLVPVSHRSHHMLDPESLWDYVDENTIGCFVILG
TTYTGHLENVEKVADVLSQIEAKHPDWSNTDIPIHADGASGGFIIPFGFEKEHMKAYGME
RWGFNHPRVVSMNTSGHKFGLTTPGLGWVLWRDESLLADELRFKLKYLGGVEETFGLNFS
RPGFQVVHQYFNFVSLGHSGYRTQFQNSLFVARAFSFELLNSSKLPGCFEIVSSIHESIE
NDSAPKSVKDYWEHPQAYKPGVPLVAFKLSKKFHEEYPEVPQAILSSLLRGRGWIIPNYP
LPKATDGSDEKEVLRVVFRSEMKLDLAQLLIVDIESILTKLIHSYEKVCHHIELASEQTP
ERKSSFIYEMLLALASPQDDIPTPDEIEKKNKLKETTTRNYRGTC
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgttacacaggcacggttctaagcagaagaacttcgagaatatcgctggaaaagttgtc
cacgaccttgcaggtctgcaattgctttctaacgacgttcaaaaatccgctgtccaaagt
ggtcatcaaggatcgaacaatatgagagatacttcgtctcagggcatggctaataagtat
tcagttccaaaaaagggactacctgctgatttgtcttaccaactgattcataatgaatta
acacttgatggtaatccgcatttgaaccttgccagtttcgtgaacacttttaccactgat
caggcaaggaaattgattgatgaaaatttgaccaaaaatcttgctgacaatgatgaatat
ccgcaattaattgagctaactcagcgttgtatttctatgctagctcaattatggcacgct
aatcccgatgaagaaccaataggctgtgccaccacaggttctagtgaggcaatcatgttg
ggtggactcgccatgaaaaaaagatgggaacacagaatgaagaatgctggtaaagatgct
tccaagccgaacattataatgtcttctgcgtgccaagtggcattagagaagtttacgaga
tattttgaagtggaatgccgattggttccggtatcccacagaagccatcatatgcttgac
ccagagtcgttatgggattatgtagatgagaacactattggctgttttgtaattttagga
accacctacactggccatttggaaaatgtagagaaagttgcagatgtcttgtcccaaatt
gaggccaagcatcctgattggagcaatactgatattccaatccatgcggatggcgcttca
ggtgggtttattatcccatttggctttgaaaaagagcacatgaaagcttatggcatggaa
cgttgggggttcaaccatccgcgtgtggttagtatgaacactagtggtcataagtttggc
ttaaccactcccggtctgggttgggtgctatggagagatgaatccttactggctgatgaa
ttgagattcaaactaaagtacctcggtggcgtggaagaaactttcggtttgaatttttca
agacctggatttcaagttgtccatcaatacttcaattttgtttctctaggccattcaggg
tatagaacacaattccaaaattctctatttgttgcaagagcgttttctttcgaattattg
aattcgtcaaaattgcccggatgctttgaaattgttagcagtatccatgaaagcattgag
aacgattccgcccctaagtcagttaaagactattgggaacacccccaggcttacaaacca
ggtgtaccgctggtagccttcaaattgtccaagaaattccacgaagaatatccagaagtg
ccacaagcaatcctttcctctttactgagaggtaggggttggataataccaaattaccca
ctaccaaaggcaacggatggatccgatgagaaggaggtattaagagtggttttcagatcg
gagatgaagttggatttagcacagttgttgatcgttgacatcgagagtatcttgacaaag
ttgattcatagttacgaaaaggtttgtcatcatatagaacttgcctctgagcaaactcca
gagcgcaagagttcgttcatctacgaaatgttgctggcattggcatctccacaagatgac
atcccaacgccggatgaaatcgaaaagaaaaataagctaaaggaaacaacaacgagaaac
tatagaggaacatgttga

DBGET integrated database retrieval system