KEGG   Streptococcus parasanguinis FW213: Spaf_1061Help
Entry
Spaf_1061         CDS       T02115                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00010  Glycolysis / Gluconeogenesis
scf00020  Citrate cycle (TCA cycle)
scf00620  Pyruvate metabolism
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01120  Microbial metabolism in diverse environments
scf01130  Biosynthesis of antibiotics
scf01200  Carbon metabolism
Module
scf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_1061 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Spaf_1061 (pdhC)
   00620 Pyruvate metabolism
    Spaf_1061 (pdhC)
Enzymes [BR:scf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Spaf_1061 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AFJ26050
UniProt: I1ZLX6
LinkDB All DBs
Position
complement(1070185..1071228)
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDILAFLPENIENETIKSPAQIEKVEEAPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYDVDMSQMLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMTLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSATVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgataagctaagagcgactcctgcggctagaaaattagcggatgatcttggg
atcaacctctatgatgtttctggttcaggcgcaaacggtcgtgtccacaaagaagacgtg
gaaacatataaagacacaaatgtggttcgcatttcaccacttgcaaaacgaattgcttta
gaacacaatattgcttggcaagagattcaaggaactggtcatcgtggcaagatcatgaag
aaggacatccttgcttttcttcctgaaaatattgagaatgagaccattaagtcacctgct
caaatcgagaaggtggaggaagctccagataatgtgacaccttatggtgagatcgagcgg
attccgatgacaccaatgcgtaaggtaatcgctcaacggatggtggaatcttacttgaca
gcaccaacctttactttgaactatgacgttgatatgtctcaaatgttggcccttcgtaag
aaggtattggatccaattatggaggccactggcaagaaagtcactgtaacagatttgctt
tctctagcagtggttaagaccttgatgaaacatccatacatcaatgcgtcattaacagaa
gatggcaaaaccatcatcactcacaattatgtcaacttagcgatggcagttgggatggac
aatggattgatgactccagttgtctacaatgctgaaaagatgactttatcagagttggtc
gtagccttcaaggatgttatcggacgtaccttggacgggaaattagcaccaagtgaattg
caaaactcaacctttaccatcagtaacttaggaatgtttggcgttcaatcatttggaccg
attatcaaccaaccaaactctgccatccttggagttagtgcaacggttgaaaaaccagtt
gttgtgaatggtgaaattgtcattcgtccaatcatgagcttgggcttgaccattgaccac
cgcgttgtcgatgggatggctggtgccaaattcatgaaagacttgaaagccttgattgaa
gacccgatttcaatgttggtctaa

DBGET integrated database retrieval system