KEGG   Streptomyces collinus: B446_04655Help
Entry
B446_04655        CDS       T02787                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
sci  Streptomyces collinus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1147759..1149492)
Genome map
AA seq 577 aa AA seqDB search
MARSLVDLLTAHASNRPERVAYRHLVTGDCDGEIQELTYGRLATRARAVAAWLQERGLAG
SRAMLLHPPGLEFVCAYLGCLAAGVIAVPGVPPQGRAQNHRALTRMKRLVADADAKVILG
GREVITALDGMAEHLPELDGIARVATEDIPDHAAASWREPELTADSVAFLQYTSGSTSAP
RGVAVTHGNLLDNERVITERMGHTPEVLAEHANELFVSWLPVYHDMGLIGPVLNTVYLGA
TATLFSPLHFLQRPDRWLTAVSRYRPHTSGGPNFAYELCLKHAGPDLLDRLDLSSWKVAF
NGAEPVRAATLRRFADTFAPAGFRREALYPCYGLAEATLMVTGGDVATGPTLLAAAEGSP
NAGEADAAAVGCGRPGPGVTVAIVHPEWHKELSDGEVGEIWVGGASVAKGYWRNALATRE
AFRAQLPGREGRFLRTGDLGFLRDGELFVTGRLKDLLVVDGRNHYPQDLELTAELAHPAL
RPGCTAAFSVDAGADGADGEQPVLVAEVAPDDAGESGKITDLVRSAVGEAHGLSVREVVL
VRPGTIPKTSSGKIQRRATRAAYLDGTLAVATGPAAP
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttccctggtcgatctactgaccgcccatgcctcgaaccgtcccgagcgcgtc
gcgtaccgccacctcgtcaccggtgactgcgacggagagatccaggaactcacctacggc
cggctcgccacccgggcccgcgcggtcgccgcctggctgcaggagcgcggactggccgga
tcccgagccatgctgctgcacccgcccggcctggagttcgtctgcgcctacctcggctgc
ctcgcggccggtgtgatcgccgtaccgggggtgcccccgcagggccgcgcgcagaaccac
cgcgcgctgacccggatgaagcgcctggtcgccgacgccgacgccaaggtcatcttgggc
ggccgggaggtgatcaccgcgctcgacggcatggccgagcacctgcccgaactcgacggg
atcgcacgcgtcgcgaccgaggacatccccgaccacgcggccgcgagctggcgggaaccc
gaactcaccgcggactccgtcgccttcctccagtacacctccggctccacctcggcaccg
cgcggcgtcgcggtcacccacggcaacctgctcgacaacgagcgggtcatcaccgagcgc
atgggccacacccccgaggtgctcgccgagcacgcgaacgagctgttcgtcagctggctg
ccggtctaccacgacatggggctcatcggccccgtcctgaacacggtgtacctcggcgcc
accgccaccctcttctcccccctgcacttcctgcagcggccggaccgctggctcaccgcc
gtgagccgctaccgcccgcacaccagcggcggccccaacttcgcctacgagctgtgcctg
aagcacgcgggccccgacctgctcgaccgcctcgacctcagctcgtggaaggtcgccttc
aacggcgccgagccggtccgcgcggccacgctgcgccgcttcgccgacaccttcgccccg
gccggcttccgccgcgaggccctctacccctgctacggcctcgccgaggccaccctgatg
gtcaccggcggcgacgtggccaccgggcccacgctgctcgccgcggccgagggctccccg
aacgcaggcgaggccgacgcggccgccgtcggctgcggccggcccgggcccggcgtcacc
gtcgcgatcgtccaccccgagtggcacaaggagctctccgacggcgaggtgggcgagatc
tgggtgggcggcgcgagcgtcgccaagggctactggcgcaacgccctcgccacccgcgag
gccttccgcgcccagctcccgggccgcgaggggcggttcctgcgcaccggcgacctcggc
ttcctgcgcgacggcgaactcttcgtcaccggccggctcaaggacctcctcgtcgtcgac
ggccgcaaccactacccgcaggacctggagctgaccgccgaactggcccaccccgcgctg
cgccccggctgcaccgcggcgttctccgtggacgccggggccgacggagccgacggcgaa
cagcccgtcctggtcgcggaggtcgccccggacgacgccggcgagtccgggaagatcacc
gacctggtccgcagcgcggtgggggaggcccacggactgtccgtgcgcgaggtcgtcctg
gtgcggcccggcaccatcccgaagacctccagcgggaagattcagcgccgcgccacccgg
gcggcgtacctcgacggcaccctcgcggtggccaccggtcccgccgcgccctga

DBGET integrated database retrieval system