KEGG   Streptomyces collinus: B446_22630Help
Entry
B446_22630        CDS       T02787                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
sci  Streptomyces collinus
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B446_22630
   00620 Pyruvate metabolism
    B446_22630
   00630 Glyoxylate and dicarboxylate metabolism
    B446_22630
  Energy metabolism
   00680 Methane metabolism
    B446_22630
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B446_22630
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     B446_22630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5201517..5202506
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHATVAGKNAAEVVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTAEGDWTSMGIPSDGSYGVPEGLISSFPVTTKDGKYEIVQGLD
INEFSRARIDASVQELAEEREAVRSLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgc
ctcctggagatcaccccggcgctcaaggccgccgagggcaccgccatggagctggacgac
tgcgcgttcccgctgctccagggcatcgacatcacggacgacccgaacgtggccttcgac
ggcgccaacgtggccctcctcgtcggcgcccgcccccgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgccgacgacatcaaggtcctcgtggtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgcgccggacgtgccggccgagcgcttcaccgcgatgacccgtctggac
cacaaccgcgcgctgacccagctcgcgaagaagaccggctcgacggtcgcggacatcaag
cgcctgaccatctggggcaaccactccgccacccagtacccggacatcttccacgccacg
gtcgccggcaagaacgccgccgaggtcgtgaacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggtgccgcgatcatcgaggcccgtggcgcctcctccgcg
gcctccgccgccaacgccgccatcgaccacgtgcacacctgggtcaacggcaccgccgag
ggcgactggacctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttcccggtcaccaccaaggacggcaagtacgagatcgtccagggcctggac
atcaacgagttctcccgcgcccgcatcgacgcctccgtccaggagctcgccgaggagcgc
gaggcggtccgttccctgggcctcatctga

DBGET integrated database retrieval system