KEGG   Sorangium cellulosum So ce 56: sce2530Help
Entry
sce2530           CDS       T00634                                 

Definition
(GenBank) acyl-CoA synthetase
Organism
scl  Sorangium cellulosum So ce 56
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3411127..3412950)
Genome map
AA seq 607 aa AA seqDB search
MRTFVEVLQQNSVHADRAVTFVRSSGEERAISYAELWLEARRRAYALRKLGLRKGDRVAL
ILTEADEFVLTFVGALTAGIVAVPMYPPQSLAKLEAYGETVQHILEASGASVLVTNEQLK
EMIDAYLAANAESREALPGLRVVLERDLRARDGSDASDASHAAEPWRVSLDDLAFLQFTS
GSTSRPKGVMVTHRNLTVNSHAIMFDGLRSTPEDRGVSWLPLYHDMGLIGFVIAPLYALV
PVMFLPTTAFIRRPSLWLDAIHRFRGTITFAPNFAFALATRAVTDAQAGSWDLSCVRALG
CGAEPIQADVLRAFLRRFSERGLRPESILPSYGMAEATLAITFSDLKAPLTTDRVDAKAM
QAGKAWPANGGASLELVSCGRPLPCHELIIAGPDGSPLGPREVGEIWVRGPSVAAGYFNE
PEATEAAFGGGWLRTGDLGYTVAGEVYLCGRSKDLIILGGKNYFPQDIERIASSVEGVRD
GHCVAFSCLTAEGAERAIVVAEAKRSVAGVAQAITQAVRAQLGVQLSEVALIKRGTLAKT
SSGKVRRREMKRRFEAGELEVASDIDEGATPSPHGDAIRASGPASRTEGGRAGGAPARVE
GVIDGIQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgttcgtcgaagtcctccagcagaattcggtgcacgccgaccgcgcagtcacg
ttcgttcgcagctccggggaggagcgagcgatcagctacgccgagctctggctcgaggcg
aggcgccgggcctacgcgcttcgcaagctcgggctccgcaagggcgaccgcgtcgcgctg
atcctgacggaggccgacgagttcgtcctgaccttcgtgggcgcgctgacggcaggcatc
gtcgccgtcccgatgtacccgccgcagtcgctggccaagctcgaggcgtacggcgagacg
gtgcagcacatcctcgaggcgtcgggcgccagcgtgctcgtgacgaacgagcagctcaag
gagatgatcgacgcctacctcgccgcgaacgcagagagccgtgaggccctgccaggcctg
cgtgtcgtcctcgagcgcgacctgcgcgcgcgcgatgggtcagacgcgtccgacgcatcg
cacgcggccgagccctggcgcgtgtccctcgacgacctcgcgttcctgcagttcacgtcg
gggagcacctcccggccgaagggcgtgatggtgacccaccgcaacctgacggtgaacagc
cacgccatcatgttcgacgggctgcgctccacgccggaagaccgcggcgtcagctggctg
cccctctatcacgacatggggctcatcggcttcgtcatcgcgccgctctacgcgctcgtg
ccggtgatgttcctgccgacgacggcgttcatccgccgcccgtcgctctggctcgacgcg
atccacagattccgcggcacgatcacctttgccccgaacttcgccttcgccctcgccaca
cgcgccgtcaccgacgcgcaggcgggcagctgggacctctcctgcgtgcgcgcgctcggg
tgcggcgccgagccgatccaggccgacgtgctccgcgcgttcctccgccgcttcagcgag
cgggggctccgcccggagagcatccttccctcgtacggcatggccgaggccacgctggcg
atcacgttcagcgacctcaaggccccgctcaccaccgatcgcgtggacgcgaaggcgatg
caggccggcaaggcgtggcccgcgaacggcggcgcctcgctggagctcgtctcctgcggt
cgccccctcccctgccacgagctcatcatcgcgggcccagacggatcgccgctcggcccg
cgtgaggtcggggagatctgggtgcgcggcccgagcgtcgccgccggctacttcaacgag
ccagaggcgaccgaggcggcgttcggagggggctggttgcggacaggcgatctcggctat
accgtcgccggcgaggtgtacctgtgcggccgctccaaggacctcatcatcctgggcggc
aagaactacttcccccaggacatcgagcgcatcgcgtcctccgtcgagggggtgcgcgac
ggccactgcgtcgcgttctcgtgcctcaccgccgagggggccgagcgcgcgatcgtcgtc
gccgaggccaagcggagcgtggccggcgtcgcgcaggcgatcacccaggccgtgcgcgcc
cagctcggcgtgcagctgtccgaggtcgcgctgatcaagcgggggacgctggcgaagacg
tcgagcggcaaggtgcggcgccgcgagatgaagcggcgcttcgaggccggcgagctcgag
gtcgcctcggacattgacgagggcgcgacgccctctccccatggcgacgcgatccgcgcg
agcggaccggcgtcgcgaaccgaagggggccgcgcgggcggcgccccggcacgtgtcgaa
ggagtcatcgatgggatccagtaa

DBGET integrated database retrieval system