KEGG   Sorangium cellulosum So ce 56: sce3427Help
Entry
sce3427           CDS       T00634                                 

Gene name
ppc
Definition
(GenBank) Family membership
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce3427 (ppc)
  Energy metabolism
   00680 Methane metabolism
    sce3427 (ppc)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     sce3427 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4781764..4784505)
Genome map
AA seq 913 aa AA seqDB search
MPPRRREVDRPLRKEVRLLGRLLGEVLIEQEGEELFAIEERIRTLAIRRRRGPSDGRAHA
AAELSKLLAELPHDRLEPVIRAFTVYFRLVNLAEQHHRIRRARAYATDPGARPQRGSIEA
AMHTLKKAGVPAERVRAALRTLDVTLTLTAHPTEAARRTVLEKLYRIAKNLEERDRCQLT
PDESARKLAEIREEITALWQTDEVRRDRPTVGDEVKNVAWYIEEILWDLLPDLPTVIGRA
FEAAYGEPLDAEIAPLRIHSWVGADMDGNPLVVPAVLEDALFAYRIRGLRRLVRAVRDLG
GALSQSVRHVTPPPWLLASIEEDAAAMPEVAAHFGPRTEGEPWRRKLHFIEARLTATLEH
AEHGRAEARARSGQGPAREGRAFVRPEEPTLAVPYREPAELERDLAVVADSLRAARCASS
GERRARALLSQVRALGFALAELEMRAPAEDARAAAASLAEGRVEPAQMTPEARRVFEALQ
RIAAAQRDGGESSCRTLVLSMTHSEDDVLAALASAKAAGLWDEARSCARIDVVPLFESLA
ALNDSARILRALLAHPEYRPHVLARGVQEVMIGYSDSGKEVGLLAASAALRRVQETLPKI
AAEAELPLRVFHGRGESVARGGGPAHQALLALPAGSVGGRYKATEQGEALDHKYARPELA
MRTLEIMLSGVLLHTLGAQPRPPAASELRYAAAFDELAETGRRAYRALVWEEPKFVEFFT
AVTPIDEIARLPLGSRPSKRRAGGLESLRAIPWVFAWTQNRAILPGWYGVGSGLEAMGQR
PEGAELLKEMMASWPFFRAVIDNVEMVLAKADMTIFAGYAELAPAAARKAVAPRIIAEYK
RTRSWLKRLTGNRRLLEGNPTLQRSISLRNPYVDPLSFLQVELLRASRGGDSGRDRSLLL
TLNGIAAGMRNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcgtcgccgcgaggtcgatcgacctcttcgcaaagaagttcgcctgctcgga
cgcctgctcggagaagtgttgatcgagcaggagggagaagagctcttcgccatcgaggag
cgcatccgcacgctcgccatccgccggcggcgcggccccagcgacggccgcgcgcacgcg
gccgcggagctcagcaagctgctcgcggagctgccccacgatcgcctcgagcccgtcatc
cgcgcgttcaccgtctacttccggctcgtcaacctcgcggagcagcaccaccgcatccgc
cgggcgcgcgcgtacgcgacggatcccggcgcgcggccgcagcgcgggtcgatcgaggcc
gcgatgcacacgctcaagaaggccggcgtgccggcggagcgcgtgcgcgccgcgctcagg
acgctcgacgtgacgctcaccctcaccgcgcacccgacggaggccgcgcggcgcacggtg
ctcgagaagctctaccgcatcgcgaagaacctcgaggagcgcgatcgctgccagctgacg
cccgacgagtcggcgcgcaagctcgccgagatccgcgaggagatcaccgcgctctggcag
accgacgaggtgcgccgcgatcgccccaccgtcggcgacgaggtgaagaacgtcgcctgg
tacatcgaggagatcctctgggatctgctccccgatctgcccaccgtgatcgggcgcgcg
ttcgaggccgcctacggcgagccgctcgacgcggagatcgcgccgctccggatccactcg
tgggtcggcgccgacatggacggcaacccgctcgtcgtgcccgccgtgctcgaggacgcg
ctgttcgcctaccgcatccgcgggctgcgccggctcgtccgggcggtgcgcgacctcggc
ggcgcgctgtcgcagtcggtccggcacgtcacgccgccgccctggctgctcgcctcgatc
gaggaggacgccgccgcgatgcccgaggtggccgcgcacttcggcccgcgcaccgagggc
gagccgtggcgccgcaagctgcacttcatcgaggcgcgcctcaccgcgacgctcgagcac
gcggagcacggccgcgcggaggcgcgcgcgcgctccgggcagggccccgcgcgcgagggg
cgcgccttcgtgcgcccggaggagccgacgctcgccgtcccctaccgcgagcccgcggag
ctcgagcgcgacctcgcggtcgtcgccgacagcctgcgcgccgcgcgctgcgcgagctcg
ggcgagcggcgcgcgcgggcgctgctctcgcaggtgcgcgcgctcgggttcgcgctcgcg
gagctcgagatgcgcgcgccggccgaggacgcgcgcgccgcggcggccagcctcgcggag
ggccgcgtcgagccggcgcagatgacgcccgaggcgcgccgcgtgttcgaggcgctccag
cgcatcgccgcggcgcagcgcgacggcggcgagtcgtcctgccgcacgctcgtgctgtcg
atgacccacagcgaggacgacgtcctcgccgcgctcgcgagcgcgaaggccgccgggctg
tgggacgaggcgcgctcgtgcgcgcggatcgacgtcgtgccgctgttcgagtcgctcgcc
gcgctgaacgacagcgcgaggatcctgcgcgcgctgctcgcgcaccccgagtaccggccg
cacgtcctcgcccgcggcgtgcaggaggtgatgatcggctacagcgactccggcaaggag
gtcggcctgctcgcggcgagcgccgcgctccggcgcgtgcaggagacgctgccgaagatc
gccgcggaggcggagctgccgctccgcgtcttccacggccgcggcgagtcggtggcgcgc
ggcggcggaccggcgcaccaggcgctgctcgccctgccggccggcagcgtcggcggccgc
tacaaggcgaccgagcagggagaggcgctcgaccacaagtacgcgcgccccgagctcgcg
atgcgcacgctcgagatcatgctgagcggcgtgctcctgcacacgctgggcgcgcagccg
cggccgcccgccgcgtccgagctgcgctacgccgcggcgttcgacgagctcgccgagacg
ggccggcgcgcctaccgcgcgctcgtctgggaggagcccaagttcgtggagttcttcacg
gccgtgaccccgatcgacgagatcgcgcgcctgccgctcggctcgcgcccgagcaagcgc
cgcgcgggcggcctcgagtcgctgcgcgcgatcccgtgggtcttcgcgtggacgcagaac
cgggccatcctcccggggtggtacggcgtcggcagcggcctggaggcgatgggccagcgc
cccgagggcgcggagctgctgaaggagatgatggcgtcgtggccgttcttccgggcggtc
atcgacaacgtcgagatggtgctcgcgaaggcggacatgacgatcttcgcgggctacgcg
gagctcgcgccggccgccgcgcgcaaggcggtcgcgccgcggatcatcgcggaatacaag
cggacgcggtcgtggctcaagcggctcacgggcaaccggcggctgctcgagggcaacccg
acgctccagcggtccatctcgctgcgcaatccttacgtcgaccccctttcattcctgcaa
gtcgagctcctgcgggcgagccgcggcggggactcggggcgcgatcgctcgctcctgctc
acgctgaacggcatcgccgccggcatgcgcaacacggggtga

DBGET integrated database retrieval system