KEGG   Sorangium cellulosum So ce 56: sce7251Help
Entry
sce7251           CDS       T00634                                 

Gene name
alr
Definition
(GenBank) High confidence in function and specificity
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    sce7251 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    sce7251 (alr)
Enzymes [BR:scl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     sce7251 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:scl01011]
 Precursor biosynthesis
  Racemase
   sce7251 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
10121876..10123015
Genome map
AA seq 379 aa AA seqDB search
MRPTRAEVNLAHLRHNLRVLERGLTGATKPQIWGVLKADAYGHGAPAVARTLERAGIPGL
CVALLEEAIELRDAGIRLPILVMGGYYGPRRDGFEEIIARDLVPVVYDAGQIERLASVVR
LEQRGRVGVHLKVDTGMGRLGAASSEIEAVLATLAKHPEVKLDGLMTHLACADADDLGVT
IEQMRLFGEIEQRAKSFGLTPRVRHASNSAAMLRLPAALLDIVRPGVALFGISPCAGLAP
DLKPVIRVRSEIVALRTIAKGDRIGYGHTWQASRESVVATVPMGYADGLSRQLSNRGAAL
VRGQRAPIAGAVSMDLTMLDVTDVPGARLGDEVVFLGTQDGPLGRGTISAEEIAGLTGTI
AWEVLTSISRRVPRFYREP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccgacccgcgccgaggtgaacctcgcgcacctgcggcacaacctgcgcgtcctc
gagcgagggctgaccggcgcgacgaagccgcagatctggggcgtgctcaaggccgatgcg
tacggccacggcgcgccagcggtcgcacggacgctcgagcgcgcagggatccccggcctg
tgcgtcgcgttgctcgaggaggccatcgagctgcgagacgccggcatccggctgcccatc
ctcgtcatggggggctactacggcccgcggcgcgatgggttcgaggagatcatcgcgcgc
gatctcgtgcccgtcgtctacgacgccggccagatcgagcgcctcgcgagcgtggtgcgg
ctcgagcagcgcggtcgcgtgggcgtccatctcaaggtcgacaccggcatgggacggctc
ggggccgcgagctcggagatcgaggcggtgctcgcgacgctcgccaagcacccggaggtg
aagctcgacgggctcatgacccacctcgcctgcgcggacgccgacgatctcggcgtgacg
atcgagcagatgcgcctcttcggggagatcgagcagcgagcgaagagcttcggcctcacg
ccgcgggtgcggcacgcctcgaacagcgcggcgatgctgcgactccctgcggcgctgctc
gacatcgtccgtccgggggtcgcgctgttcggaatatcgccgtgcgcggggctcgcgccc
gacctcaagccggtcatccgggtgcgcagcgagatcgtcgcgctgcgcacgatcgcgaag
ggcgacaggatcggctacggccacacctggcaagcttcccgggagagcgtcgtggccacc
gtgccgatggggtacgccgacggcctgagccgccagctctcgaaccgtggggccgccctc
gtgcgcggtcaacgcgcgccgatcgcgggcgccgtgtcgatggatctcacgatgctcgac
gtgacggatgtaccgggagcacgcctgggggatgaggtggtgttcctcggaacgcaggac
gggccgctcgggcgcggcacgatcagcgctgaagagatcgcggggctcacggggacgatc
gcctgggaggtgctgaccagcatctcgcgccgcgtgcccaggttctaccgcgagccctga

DBGET integrated database retrieval system