KEGG   Streptomyces clavuligerus: BB341_07940Help
Entry
BB341_07940       CDS       T04717                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sclf  Streptomyces clavuligerus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sclf00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BB341_07940
Enzymes [BR:sclf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BB341_07940
DNA repair and recombination proteins [BR:sclf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BB341_07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2068905..2069795
Genome map
AA seq 296 aa AA seqDB search
MTPITEVAGRRVPLSNLDKVIHPASGTTKGEILHYYATVAGAILPHLRERPVSFLRYPDG
PAGALFFTKNPPPGTPSWVRTVPVPHTDDPGARQVVLDGLAPLMWAANLVVEFHTPQWTA
AEPGVADRLVLDLDPGEPAGLPECCAVALWLRERLAADGLDAYAKTSGAKGLHLLVPIAP
TPSAAVSAYAKGLALAGEAGLPELVLHRMKRALRPGKVFVDHSQNAAAKTTATPYTLRAR
ALPTVSTPVTWDEVESAARGGEGLVFLPDDIAGRLARHGELLAPLTDPGRDRPPLP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgatcacagaggtggcggggcgacgggtgccgctcagcaatctcgacaaggtc
atccaccccgcctccgggaccaccaagggcgagatcctgcactactacgccaccgtcgcc
ggggcgatcctgccgcatctgcgggagcggcccgtctccttcctccgctatccggacggc
ccggcgggagcgctcttcttcaccaagaacccgccgcccggtactccgtcgtgggtacgg
accgttcccgtgccgcacacggacgacccgggcgcccggcaggtcgtcctcgacgggctc
gccccgctgatgtgggcggcgaacctggtggtcgagttccacaccccgcagtggacggcc
gcggaacccggcgtcgccgaccggctcgtcctcgacctcgaccccggcgagcccgccggg
ctccccgagtgctgcgcggtggccctgtggctgcgggagcggctggcggccgacgggctc
gacgcgtacgcgaagacctcgggggccaaggggctgcatctgctggtcccgatcgcgccc
acgccgtcggcggcggtgtcggcgtacgcgaagggactcgccctcgcgggcgaggccgga
ctgccggagctggtgctgcaccggatgaaacgggcgctgcggccggggaaggtcttcgtc
gaccacagccagaacgccgccgccaagaccacggccacgccgtacacgctcagggcacgg
gcgctgccgaccgtctcgacccccgtgacctgggacgaggtggagtccgcggcccggggc
ggcgaggggctggtcttcctcccggacgacatcgccggccgtctcgcacggcacggggag
ctgctcgccccgctcaccgacccgggccgggaccggcccccgctgccgtga

DBGET integrated database retrieval system