KEGG   Streptomyces clavuligerus: BB341_15285Help
Entry
BB341_15285       CDS       T04717                                 

Definition
(GenBank) hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
sclf  Streptomyces clavuligerus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sclf00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BB341_15285
Enzymes [BR:sclf01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BB341_15285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3772749..3774143
Genome map
AA seq 464 aa AA seqDB search
MSETHAATMPETHEFQEIHEIHETGKAPVTPQHTASTTPGLPSRRAAALDGADRLAPLRG
LFALDGTVYLDGNSLGALPAHVPGRIADVVTRQWGGLRIRSWTESGWWTAPERIGDRIAP
LVGAAPGQIVVGDSTSVNVFKAVVGAVRLAGTDTSRETPGTDAPGTGGGARTEVLVDAST
FPTDGYIAASAARLTGCRIVPVDPADVPSALGPTTAAVLLNHVDFRSGRLHDLPALTEAI
HRAGALAVWDLCHSAGALPVGLDAHGVDLAVGCTYKYLNGGPGSPAFLYVAERHQAAFDS
PLPGWNSHRDPFAMDSGYAPADGPLKGRVGTPDILSMLALDAALDVWDGVSVDDIRAKSL
ALTDFFLECLDERLPGGLGDPGCPVRPVTPREHAERGSQIALRCDRAPVVMERLIARGVV
GDLRRPDLLRFGFTPLYTSFADVERAAATLVEVAAEVYGEPSGG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacccatgccgcgaccatgcctgagacccacgagttccaagagatccatgag
atccacgagaccggtaaggcccctgtgactccccagcacaccgcgtccaccacccccgga
ctcccctcccgccgcgccgccgcgctggacggagcggatcgactggccccgctgcgcggg
ctgttcgccctggacgggaccgtctatctcgacgggaactcgctgggcgcgctgcccgcg
cacgtccccggccggatcgccgatgtcgtcacccggcagtggggcgggctgaggattcgc
tcctggaccgagagcggctggtggaccgcgcccgagcggatcggcgaccggatcgccccg
ctggtcggcgcggccccggggcagatcgtggtcggcgactccaccagcgtgaacgtgttc
aaggcggtggtcggcgcggtccggctcgccggtacggacacctcccgggagacccccggt
accgatgcgccgggtacggggggaggggcccgtaccgaggtgctcgtggacgcgagcacc
ttccccaccgacggctatatcgcggcgtcggcggcccggctgacgggctgccggatcgtc
cccgtcgaccccgccgacgtgccctcggccctcgggccgacgacggcggccgtgctgctc
aaccatgtcgacttccgcagcggccgcctgcacgacctgcccgcgctcaccgaggcgatc
caccgggcgggcgcgctcgcggtctgggacctctgccacagcgcgggcgcgctccccgtg
gggctcgacgcgcacggcgtggacctcgccgtcggctgtacgtacaagtacctcaacggc
ggccccggctcgcccgcgttcctgtatgtcgccgagcgccaccaggcggccttcgactcc
ccgctgcccggctggaattcgcaccgcgaccccttcgccatggacagcggctacgccccg
gcggacggcccgctgaagggccgggtgggcacaccggacattctgtcgatgctcgcgctg
gacgcggcgctcgacgtctgggacggggtgtcggtcgacgacatccgggcgaagagcctg
gcactcaccgatttcttcctggagtgcctggacgaacggctgcccggcgggctcggcgac
ccgggctgtccggtgcgcccggtgaccccccgggagcacgcggagcgcggcagccagatc
gccctgcgctgcgaccgggccccggtggtgatggaacggctcatcgcccgtggcgtggtg
ggcgatctgcgccgcccggatctgctgcgtttcggtttcaccccgctgtacacgtcgttc
gcggacgtggaacgggccgccgcgaccctggtggaggtcgcggcggaggtatacggcgag
ccctcgggcggatga

DBGET integrated database retrieval system