KEGG   Sphingobium cloacae: SCLO_1014230Help
Entry
SCLO_1014230      CDS       T05301                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sclo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCLO_1014230
Enzymes [BR:sclo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SCLO_1014230
Transporters [BR:sclo02000]
 Other Transporters
  Pores ion channels [TC:1]
   SCLO_1014230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_3 GST_N_2 GST_N GST_C_6 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: BAV64463
UniProt: A0A1E1F1R7
LinkDB All DBs
Position
SCLO_1:complement(1650552..1651154)
Genome map
AA seq 200 aa AA seqDB search
MKLYYAPYACSLAVHIVALEAGVSLDLVKVDLDGYTLPDGSDYRSVNPRGYVPVLEFDDG
ERLTETAVLVQYLADSGSHRELLPAFGTRERLRAQSWLNVIATELHKTFSWLWRDDTPEE
TRQIVRAKLADRFAELDGLLAAQPFLTGTQFTVVDAYAFTVVDWANHVDIDLSAYPNLSA
FMVRVGDRPSVQAALREEGE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctattacgcgccttatgcctgttcgctggccgtccacatcgtcgcgctcgaa
gcgggggtgagcctggacctggtaaaggtcgacctggacggttacacgcttccggacggt
tcggattatcggtcggtcaatccccgcggctatgtgccggtgctggagttcgacgatgga
gagcgtttgaccgaaacggccgtgctggtgcagtatctggccgacagcggaagccatcgc
gagcttttgcccgccttcggcacgcgcgagcggcttcgggcgcaaagctggctcaatgtc
atcgcgacggaattgcacaagacgttcagctggctctggcgcgacgacacgcccgaggag
accaggcagatcgtgcgcgccaagctggcggatcgctttgccgaactcgacggcctgctg
gccgcgcagccctttctcacgggaacgcagttcaccgtggtggacgcctatgcctttacc
gtcgtggattgggccaatcatgtcgacatcgatctgagcgcctatcccaatctgtcggcc
ttcatggtgcgtgtcggggatcgcccgtccgtccaggccgccttgcgggaagagggcgaa
tag

DBGET integrated database retrieval system