KEGG   Schizophyllum commune: SCHCODRAFT_111229Help
Entry
SCHCODRAFT_111229 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SCHCODRAFT_111229
Chromosome and associated proteins [BR:scm03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     SCHCODRAFT_111229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 9592206
NCBI-ProteinID: XP_003029256
JGI: Schco1_111229
UniProt: D8QBG3
LinkDB All DBs
Position
Unknown
AA seq 1091 aa AA seqDB search
MLRHRDTDSELGALYLVPNREGTGKTLVRRPNPPPTSPPLDDDFDAMTQAGTTTRGAQTE
WGTHLRESRAFTATPLGSDFDACTYTAAPGETRSEWQMAMGQANATRGTPQASPRKGPGS
SSTRVLAGEGRQTPSRAGSVARHVTGRSGSEWGQSQDGWPQGPPRGAVVRRSPTTTSRAS
SKRLPNPPSERDWPPPVRRETEIIQGNTEFSMVRRRVLEDSPQKTVTISTWREQVAEEAA
QATEPEPEMSVYFVGADDYPESVAPVPGSTRVIEEVRGLGMDSSARSASPPMLPQGTTPP
RKASYGSRADSRRTGTSSSPRSLPSPPPRTSTPNGVNSPTAQLNRRYTHSRRGSSPNRRI
LSSLFHPTQSGATISSIKTPEGAFDRVLDSCEPSLLHIAPVLESLGMTSEEHLRAVARLS
EDTRDKEIREEALRMGVTIVEWAILIDKLQTFYGKVAGLRNRLTGLHKAETGQREAACPQ
ADFPRERRVAVASINLKLKFNLTRIFAVQMSSPHSGGQHTFYVQNKCFDHQYIRSTDLSA
IVERPERLRAVLVGLSAANSRLGELVPSSKSSEVKRESTPSDELADALARLDISPNKDSG
KGDNQAWSIRHTDAAVKMLDNPAVKFVHGDIDGDVYLENLTKWAKESTEKIRQGGSEIPE
GYAQGDLYLCPESIDAMQGAMGTVCEAVDDVIAGRTRRAFAAIRPPGHHCGEDTPSGFCF
VNNVVVGAAHAHLKHGVRRVVVFDIDLHHGNGTQSLIWQINEETYRQTLESEAGAPDVKP
GPQMYYSSLHDILSYPCEDGKPALVQAASVSIRGEHGQHVENVHLQTWKSQEEFDALYQS
QYTRIIRRAEEFLDKTGGPGKDVLVFISCGFDACEHEYESMQRHKRNVPTSFYYQFARDA
CAFSDRYADGRLISVLEGGYGDRALISGSLAHLCGLSDLPGVRPEWWNVDNLVKLEKAIK
KRRGGRASLATPEPWLDRATANFDALKERIPQLSEKGKTSKAPIPPRSMQLRQRKKPGDP
VSPPTSRPASRPSSAAASPAAAGRKKHPAESTTSESSLTESEEETPKPTADASAAKKLPR
VVLKLGPRPQE
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgctgagacatcgtgacacagacagcgagctgggcgcattgtacctagtgcccaaccga
gagggcacgggcaagacgcttgtgcggcgcccgaacccgccgccgacgtcgccgccgctg
gacgacgacttcgatgcgatgacccaggcgggaacgacgacgcgcggcgcgcagacggag
tggggcacacacctgcgcgagtcccgggcgttcacggcgacgccgctggggagcgacttt
gacgcttgtacttacacagcagccccgggagagacgcgctcagagtggcaaatggccatg
gggcaggcgaatgcgactcggggaacgccgcaggctagtccgaggaagggccctgggtcg
tcgagtacgcgggttctggcgggcgaggggcggcagactccgtcgcgcgcggggtcagtt
gcgcgccatgttaccgggcgcagtggtagcgagtggggccagtcgcaggacggatggcct
cagggacctccccgcggcgcggtcgttcggcgaagcccgaccacgacgagccgcgcgagc
agcaagcgcctacctaatccgccttcggagcgcgattggccgccgcccgtgcgtcgcgag
acagagatcatccaggggaacaccgagttttcgatggtccggcggcgcgtcctagaggat
agcccacagaaaacggtgactatttcgacatggcgcgagcaagtggcggaggaggcggcg
caggcaactgagccagagccggagatgagcgtctactttgttggcgcagacgactatccg
gagtcagtcgcgccggttccggggagcacgcgtgtaatcgaggaggtgcgggggcttggg
atggatagcagcgcaaggagtgcttctcctccaatgctgccgcaaggaactacgccgccc
aggaaggcatcgtacggctctagggcagatagtcgaaggaccggcacttcgtcctcgccg
cggtcgcttccaagccctccgccacgaacttcgacgccgaatggcgtgaacagccctact
gcccagctgaaccgacgatacacacatagccgccggggatccagccccaatcggcgtatt
ctatcctctttgttccaccccacgcagtcgggagcgaccatcagttccatcaagactcct
gagggcgcttttgatcgcgtacttgattcgtgcgagccttctctactgcacatcgcgcca
gttttggaaagtctggggatgacgagcgaggagcaccttcgagcggttgcgcgcttatcc
gaggacacgagagacaaggaaattagggaggaggcgctgaggatgggtgtaacgatcgtt
gaatgggctatcctgattgacaagctgcagaccttctatgggaaagtagcagggctacgc
aatagactcacagggctgcacaaagccgagaccggtcaacgcgaggcagcctgccctcaa
gctgatttcccacgtgagcgtcgcgtcgctgtggcgtcgatcaatctcaagttgaagttc
aacttgacccggatcttcgctgtccagatgagctcgcctcactcaggaggccagcacacc
ttctatgtgcagaacaaatgcttcgaccatcaatatattcgctcaacggacctttctgcc
atagtagaaaggcccgagcgtcttcgcgcggtcctcgtgggcctatcggctgcgaactcg
cggttgggggagcttgtaccctctagcaaaagctctgaagtcaagcgcgagtccacacca
tccgacgagctcgccgacgctctggcccgcctcgacatcagcccaaacaaagatagtggc
aagggagacaaccaagcttggagcattcggcatacagatgcggcggtgaagatgcttgac
aatcctgctgtcaagtttgttcatggcgatattgacggcgatgtgtacctcgagaacctg
accaagtgggcgaaggagagcacggagaagatacgacagggagggtcagaaattcccgag
gggtatgcgcaaggtgacctatatctgtgtccagaatctatcgatgcgatgcagggggcg
atgggtaccgtctgcgaagcagtcgacgatgtcatcgctggccgcacccggcgcgccttt
gccgcaataaggccaccaggtcatcattgtggcgaagacacaccctcagggttttgcttt
gttaacaacgtcgtggttggcgctgcgcatgcccatttaaagcacggcgtccggcgcgta
gtcgtcttcgacatagacctccatcatggaaacggaacacagtcgctcatctggcaaatc
aacgaagagacctaccgtcaaactctggaaagcgaagccggcgcaccagacgtgaagcca
ggaccgcaaatgtactactcatcgctgcatgacatactgtcatatccctgcgaggacgga
aagcccgcgctcgtgcaagctgcctccgtctccattcgtggagagcacggacagcatgtc
gagaacgtacatctccaaacttggaagtcgcaagaagagttcgacgcgctataccagtca
caatataccaggatcatccgtcgagccgaggaattcctcgataaaacgggtggcccggga
aaggacgtgctcgtcttcatcagctgtggatttgatgcctgcgagcacgagtacgaatcg
atgcagcgccacaagcgcaacgtaccgacttcgttttactaccagttcgcgcgggacgcc
tgcgcgttcagtgaccgttatgccgatgggagactgattagtgtcctcgagggcggctac
ggcgaccgcgctctcatcagcggctcacttgcgcacctctgcggtctatccgatctacca
ggcgtccgtcccgaatggtggaacgtagacaacctcgtgaagctcgaaaaagccatcaaa
aagcgccgcggcggacgcgcatccctcgccacccccgagccctggctcgaccgcgccacc
gcaaacttcgacgcgctcaaggagcggatcccgcagctgagcgagaaggggaagacgagc
aaggcgccgatcccgcctcgatcgatgcagcttaggcagaggaagaaaccgggggatccg
gtgtcgccgccgacatcgagacctgcatcgaggccttcgtccgcagctgcgtcgcctgcg
gctgctggtaggaagaagcatcccgcagagtcgacgacgtcggagtcgtcgttgaccgag
agtgaggaggagacgccgaagcccactgcagatgcgagtgccgccaagaagctgccgcgc
gtggtcctgaagcttgggccgcggccacaggag

DBGET integrated database retrieval system