KEGG   Schizophyllum commune: SCHCODRAFT_46359Help
Entry
SCHCODRAFT_46359  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
scm  Schizophyllum commune
Pathway
scm03030  DNA replication
scm03410  Base excision repair
scm03420  Nucleotide excision repair
scm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SCHCODRAFT_46359
   03410 Base excision repair
    SCHCODRAFT_46359
   03420 Nucleotide excision repair
    SCHCODRAFT_46359
   03430 Mismatch repair
    SCHCODRAFT_46359
Enzymes [BR:scm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCHCODRAFT_46359
    6.5.1.6  DNA ligase (ATP or NAD+)
     SCHCODRAFT_46359
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SCHCODRAFT_46359
DNA replication proteins [BR:scm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SCHCODRAFT_46359
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SCHCODRAFT_46359
DNA repair and recombination proteins [BR:scm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SCHCODRAFT_46359
   NER (nucleotide excision repair)
    Other NER factors
     SCHCODRAFT_46359
   MMR (mismatch exicision repair)
    Other MMR factors
     SCHCODRAFT_46359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 9584930
NCBI-ProteinID: XP_003038632
JGI: Schco1_46359
UniProt: D8PQ82
LinkDB All DBs
Position
Unknown
AA seq 833 aa AA seqDB search
QGSGTFFAMPKSAKATPPQQASLKEMWGKKKASTSAKSAKDASDSANSEVKPSKPASGAC
AYTEDELRPETSTGEKTAKAIESDDEEAPTSSQKATSKKTSLKQTKTKKDKATAADSKSE
GRRRPKKASEKAAPATSDAEPDAEASVPPSSDVEAAEEEEDEDDEALLEDEEGEGAATRA
VAAKAAEAALARTSDVDIKGGWKVGDPVPYAALTKTFSHIESTTKRLEKNAFLTAFLTLV
IQRSAPNDHNSLLQAVYLCINRLSPDYIGIELGIGESLLIKAISESTGRNAGLIKADLKK
EGDLGLVAMNSKNSQRTLFKPKPLTLPFVFSNLKEIALSSGHSSQTKKVSIITKLLAACQ
DFEAKYIVRSLEGKLRIGNAERSVLVALAHAAVLAENAKRDRKLHGEKLAARLEESTNIV
KAVYSELPSYDKVIPALLDHGIDGLREHCKLSPGVPLKPMLAKPTKAIGEVLDRFENKRF
TCEYKYDGERAQVHLMEDGKIAVFSRNSEDMSKKYPDLMEQIPRCIKDSTKSFVLDAEAV
AIDRTTGKLMPFQELSKRKRKDVKVEDIQVKVCLFAFDLLYLNGEPLLQKSLAERRVLLR
ESFQIVESEFQFAKSTDSETVEEIQTFLEESVKDGCEGLMVKMLESDASYYEPSRRSINW
LKLKKDYLAGVGDSLDLVVVGGYYGKGKRTNVYGAFLLACYDADSEEYQTICKIGTGFSE
EALQSHYNVLKPLEMEKPRGDIKVGGAKPDIWFEPKVVWEVLTADLSLSPVYTAAMGLVD
ERGISLRFPRFIRIRDDKNADNATGCEQVAEMYERQALAQGGGKKGKVVDDFW
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
caaggctcaggaacattcttcgcgatgcctaaatctgccaaggcgactccccctcagcag
gccagcctcaaggaaatgtggggcaagaagaaggcatctacgagcgccaagtccgccaaa
gacgcgtcagattccgccaattccgaagtgaagccttccaagccagccagcggtgcgtgt
gcctatacagaagatgaacttcgccctgaaaccagcacaggcgagaagacggccaaagcg
atcgagtccgacgatgaagaagcgcccacttcctcgcagaaggcaacttcgaagaagacc
tctttaaagcagaccaagaccaagaaagataaggctactgcagcagactccaaatctgaa
ggtcgtcgccgacccaagaaagcgtcggagaaggctgcaccagcgacgtcggacgctgaa
ccagacgccgaagccagtgtacccccgagcagtgatgttgaagcggcagaggaagaggag
gatgaagacgatgaggctctgcttgaagatgaggaaggcgagggggctgctactcgcgcg
gttgcagcgaaagccgctgaagccgcattagcacgcacttcagatgttgacatcaaaggt
ggctggaaagtcggagacccagtaccgtatgccgcgctcacgaagactttctctcacatc
gagtccacaacgaagcgactggagaagaatgccttcctcacagcattcctgaccctcgtc
atacaacgcagcgcgccaaacgaccacaactcgttgcttcaagccgtctacttgtgcatc
aacaggctcagtccagattacatcggcatcgagctgggtatcggcgagagtctgctcatc
aaggcgatcagcgagtcgactggacgaaacgcgggcctcatcaaggctgacctaaagaag
gagggtgacctcgggctcgtcgccatgaactcgaagaacagtcagcggacgctgttcaag
ccgaagcctctgacgctacctttcgtcttctcgaacctcaaggagatcgcgctctcttct
ggtcattcctcgcaaaccaagaaagtatccatcattacgaagctgcttgctgcatgtcag
gactttgaggcaaagtacatcgtgcgtagtctagagggcaagctgcgcattgggaatgcg
gagagatctgtacttgtcgccctagcgcatgctgcagttttggccgagaatgcaaagcga
gatcgcaaactacatggcgaaaagctcgctgctcgcttggaagagagcacgaatatagtc
aaggctgtatacagtgagctgccctcatacgacaaggtcatacctgcactgctcgaccac
ggcatcgacggcttgcgagagcactgcaagctttccccgggcgtacccctcaagcctatg
ttggccaagccgacgaaggctataggcgaggtgctcgatcggttcgagaacaagcgcttc
acttgcgagtacaagtacgacggggagcgtgcgcaggtgcacctcatggaagacggtaag
atcgcggtgttcagtcgcaactcggaggacatgagcaagaagtatcctgatttaatggag
cagattccgcggtgtatcaaagacagcaccaagtccttcgtcttggatgccgaagctgtc
gccatcgaccgcacgactggcaagctcatgcccttccaagagctcagcaagcgcaagcgg
aaggatgtcaaggtcgaggacatccaggtcaaagtctgcttgttcgcgttcgacttgttg
tacctcaacggcgagcctttgctgcaaaaatcgttggcagagcgccgcgtgctcttgcgc
gagtccttccagattgtcgagagcgaatttcagttcgccaagtcgacggatagcgaaacg
gtcgaggagattcagacgttcctcgaagaaagtgtgaaggatggctgcgagggcttgatg
gtcaagatgcttgagtcagacgccagctactacgagccaagtcgacgcagtatcaactgg
ctgaagctcaagaaggactacctcgccggtgtcggcgattcactcgaccttgttgtcgtc
ggcggctactacggcaagggcaagcgcacgaatgtctatggcgccttcttgctcgcctgc
tacgacgccgactccgaggagtaccaaacgatatgcaaaatcggtaccggattcagcgaa
gaggcgctacaatcgcactacaatgtactgaagcccctcgagatggagaagccgcgcggg
gacatcaaggtcggaggcgcgaagccagatatctggttcgagcccaaggtcgtctgggag
gtcctgacggcggacttgagtctgagtccagtgtacacggcagcgatgggattggttgac
gagcgcggcatatcgttgcgctttccgcggttcattcggatacgcgatgacaagaacgcc
gacaatgcgacgggctgtgagcaggtcgcggagatgtacgagcgacaagcgcttgcgcaa
gggggtggcaagaagggcaaggtggttgatgacttctggtag

DBGET integrated database retrieval system