KEGG   Solitalea canadensis: Solca_4219Help
Entry
Solca_4219        CDS       T02084                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scn  Solitalea canadensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Solca_4219
   00020 Citrate cycle (TCA cycle)
    Solca_4219
   00620 Pyruvate metabolism
    Solca_4219
Enzymes [BR:scn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Solca_4219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4906406..4908031
Genome map
AA seq 541 aa AA seqDB search
MAEVVRMPKMSDTMTEGVLAKWHKKVGDKVKSGDVVAEVETDKATMDFESFQEGTLLYIG
VEEGQAVPVDAVIAVLGAEGEDYKAALAAEGGNGKAAAAPAEAKAEAAPAPVQSSAPAVT
PESLGATVIRMPLLSDTMTEGVINKWYKKIGDTIKSDDTIADVETDKATMEVTAYAEGTL
LYIGVEEGKAAKVNDIIAIVGKPGTDVSPLLQAAPAAAPAKEEASAGSTAASATSAPVAE
ASTADANGRVKASPLARKIAEEKGIDLAQVKGSAEGGRIVKKDVETFTPSAAPTAKAATP
GAGATTVAAPAVYGQESFTEVAVTQMRKTIARRLSESLFTAPHFYLTMSIDMDQAMEARK
RINELGTIKISFNDIVLKAVAVALKKHPKVNSSWLGDKIRYNNHVNIGVAVAVEDGLLVP
VVRFADTKSLSTISTEVKEYAQKAKDKKLQPADWEGSTFTISNLGMYGIDQFTAIINPPD
ACILAVGGISQVPVVKNGQVVPGNVMKVTLSCDHRVVDGATGSEFLQTLKGLLEEPLRLL
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagtacgcatgccaaaaatgagcgataccatgaccgaaggggtattggct
aaatggcataaaaaagttggtgataaagtaaaatcaggcgacgtagttgctgaggttgaa
accgacaaagctaccatggattttgaatcgttccaggaaggaacattattatacatcgga
gttgaagaaggccaggccgttccggttgatgcagtaattgctgttttgggtgccgaaggt
gaagattacaaagctgcattagctgccgaaggtggaaatggtaaagctgctgctgcacct
gctgaagccaaagctgaagctgccccggctccggttcaaagtagcgctcctgctgtaact
cctgagtctttaggtgctactgtaattcgcatgcctttgttaagtgataccatgactgaa
ggtgttattaacaagtggtacaaaaaaatcggtgatactattaagtcagatgatactatc
gctgatgttgaaaccgataaagctacaatggaagtaactgcttatgcagaaggaacctta
ttatacatcggtgttgaagaaggtaaagctgctaaagtgaatgatattattgcaattgtt
ggtaagccaggaacagatgttagtccgttattacaggctgcgcctgcagctgctcctgct
aaagaagaagctagtgctggatcaacagctgcttctgctacatcagcaccagttgctgaa
gcttcaacagcagacgccaatggtcgtgtaaaagcatctccgttggctcgtaaaattgca
gaagaaaaaggcattgaccttgcccaagtaaagggcagtgcagaaggtggacgcattgtg
aagaaggatgtagagacctttactccttcagcagctcctaccgctaaagcagcaactcct
ggtgctggtgcaactacagttgcagctcctgctgtttatggtcaggaaagctttactgag
gttgctgtaacacaaatgcgcaagacaattgctcgtcgtttgtctgaaagtttattcacc
gctcctcacttctacttaaccatgtctattgatatggatcaggcaatggaagctcgcaag
cgtatcaatgaattaggtactataaaaatctctttcaatgatatcgtattaaaagcggtt
gcagttgcattgaaaaaacaccctaaagtaaattcaagctggttaggagataagatccgt
tataacaaccacgtaaatattggtgtagctgtagctgttgaagatggcttgttagtaccg
gttgttcgttttgctgatactaaatcattgtcaactatctctactgaagtaaaagaatac
gctcaaaaagcaaaagataaaaaattgcaaccagctgattgggaaggctcaacctttacc
atttctaacttaggtatgtacggtattgatcagtttactgcgatcattaacccacctgat
gcttgtatcttagcggttggtggtatcagccaggttccggttgttaaaaatggacaagtt
gttcctggtaatgtaatgaaagttactttatcttgtgatcaccgagttgttgatggtgct
actggttcagagttcttacaaacgttaaaaggtttactagaagaaccattgagactttta
gtgtaa

DBGET integrated database retrieval system