KEGG   Streptomyces coelicolor: SCO3645Help
Entry
SCO3645           CDS       T00085                                 

Gene name
SCH10.23c
Definition
(RefSeq) hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCO3645 (SCH10.23c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SCO3645 (SCH10.23c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
complement(4023366..4024598)
Genome map
AA seq 410 aa AA seqDB search
MSEPTSLVGEAEQLDAADGLAAVRERFVLDDVTYLDGNSLGALPAHVPARVADVVRRQWG
ELRIRSWEESGWWTAPERIGDRIAPLVGAAAGQVVVGDSTSVNVFKALVAAVRMAQEDGR
GGARTGPVRDEILVDATTFPTDGYIAESAARMTGCALRPVAPAEVPGALGDRTAAVLLNH
VDYRSGRLHDLPGLTAAVHAAGAYAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGP
GSPAYLYVRRDLQPRFDSPLPGWNSHAEPFGMRPAYAPASGAVRGRVGTPDILSLLALDA
ALDVWDEDAVSVAAVRAKSLALTDFFLRCVGAYVPDGRVESVTPAAHAERGSQVALRCDD
AGEVMKRLIERGVVGDYRAPDVLRFGFTPLYVGFADVERAARVLARTLAG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagccgacgagcctcgtgggcgaggcggagcagctggacgccgccgacgggctg
gcggcggtgcgcgagcgtttcgtcctcgacgacgtgacctacctcgacggcaactcgctg
ggcgccctgcccgcgcacgtccccgcgcgcgtggcggacgtcgtacgacggcagtggggc
gagctgcgcatccggtcctgggaggagagcggctggtggaccgcgcccgagcggatcggc
gaccggatcgccccgctggtcggcgcggccgccggccaggtcgtggtcggcgactcgacc
agcgtcaacgtcttcaaggcgctggtcgccgcggtgcgcatggcgcaggaggacggtcgt
ggcggtgcgcggaccgggccggtccgggacgagatcctggtcgacgccaccaccttcccc
acggacgggtacatcgccgagtcggcggcccggatgacgggctgtgccctgcggcccgtg
gccccggccgaggtccccggcgccctgggcgaccgcaccgccgcggtgctgctcaaccac
gtcgactaccgctcgggccggctgcacgacctgcccggactcacggccgcggtgcacgcg
gcgggggcgtacgcggtctgggacctgtgccacagcgcgggcgcgctgccggtcgggctc
gacgagcacggcgtcgacctggccgtcggctgcacctacaagtacctcaacggcggcccc
ggctcacccgcgtacctgtacgtgcgccgtgacctccagccccgcttcgactccccgctg
ccgggctggaactcgcacgccgagccgttcggcatgcggcccgcctacgccccggcctcc
ggagcggtgcgcgggcgggtcggcacgccggacatcctctccctgctcgccctggacgcg
gcgctggacgtgtgggacgaggacgcggtctcggtggcggccgtgcgggccaagtcgctg
gcgctgacggacttcttcctgcgctgtgtcggggcgtacgtcccggacggccgcgtggag
tccgtgaccccggcggcgcacgccgagcgcggcagccaggtcgcgctgcgctgtgacgac
gcgggcgaggtgatgaagcggctgatcgagcgcggggtggtcggcgactaccgcgccccc
gacgtgctgcgcttcggcttcaccccgctgtacgtcggcttcgcggacgtggagcgggcg
gcgcgggtgctggctcggacactggccggctga

DBGET integrated database retrieval system