KEGG   Streptomyces coelicolor: SCO6222Help
Entry
SCO6222           CDS       T00085                                 

Gene name
SC2H4.04c
Definition
(RefSeq) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco00290  Valine, leucine and isoleucine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO6222 (SC2H4.04c)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO6222 (SC2H4.04c)
   00220 Arginine biosynthesis
    SCO6222 (SC2H4.04c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCO6222 (SC2H4.04c)
    2.6.1.66  valine---pyruvate transaminase
     SCO6222 (SC2H4.04c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class I
   SCO6222 (SC2H4.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 1101663
NCBI-ProteinID: NP_630323
Kitasato: SCO6222
UniProt: O86587
LinkDB All DBs
Position
complement(6843172..6844380)
Genome map
AA seq 402 aa AA seqDB search
MEFRQSNKLSEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPALFGFEAPEEIVQDMIRM
LPRAHGYTDSRGILSARRAVAQRYQALGLEVDVDDVFLGNGVSELISMAVQALLEDGDEV
LIPAPDFPLWTAVTTLAGGKAVHYLCDEQAEWYPDLADMEAKITDRTKAVVIINPNNPTG
AVYPKEIVEGILDLARRHGLMVLADEIYDQILYDDAVHHSAASLAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPKQHARDYLEGLTMLASMRLCANAPAQYAIQAALGGRQSIRELTAP
GGRLHEQRDVAWEKLNEIPGISCVKPKGALYAFPRIDPAVHKIHDDERFVLDLLLREKIQ
VVQGTGFNWPSPDHFRILTLPHAEDLEAAIGRIGRFLSGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtcgaacaagctcagcgaggtctgttacgagatccgcggcccggtc
atcgagcacgccaacgcgctggaggaggcggggcacagcgtgctgcgcctgaacaccggc
aaccccgccctcttcgggttcgaggcgcccgaggagatcgtccaggacatgatccgcatg
ctgccgagggcgcacggctacacggactcgcgcggcatcctctccgcccgccgggccgtc
gcccagcgctaccaggcgctcggcctggaggtggacgtggacgacgtcttcctgggcaac
ggcgtctcggagctgatctccatggccgtgcaggccctccttgaggacggcgacgaggtg
ctgatccccgcccccgacttccccctctggacggcggtgaccaccctcgcgggcggcaag
gcggtgcactacctctgcgacgagcaggccgagtggtaccccgacctggccgacatggag
gcgaagatcaccgaccgcaccaaggcggtcgtcatcatcaaccccaacaaccccaccggc
gccgtctaccccaaggagatcgtcgagggcatcctcgacctcgcccgccggcacggcctg
atggtcctcgccgacgagatctacgaccagatcctgtacgacgacgccgtgcaccactcg
gccgcgtccctcgcccccgacctggtggtgctgaccttctgcggcctgtccaagacgtac
cgggtggcgggtttccgctccggctggctggtggtgacggggccgaagcagcacgcgagg
gactacctggagggcctgaccatgctggcctccatgcgcctgtgcgccaacgcgcccgcc
cagtacgccatccaggccgcgctcggcggccgccagtccatccgcgagctgacggccccc
ggcggacggctgcacgagcagcgggacgtcgcctgggagaagctcaacgagatccccggc
atctcctgcgtcaagcccaagggcgcgctgtacgccttcccgcgcatcgacccggccgtc
cacaagatccacgacgacgagcgcttcgtcctggacctgctgctgcgggagaagatccag
gtggtgcaggggacgggcttcaactggccctcccccgaccacttccgcatcctgaccctg
ccgcacgcggaggacctggaggccgcgatcggacgcatcgggcgcttcctgagcgggtac
cggcagtag

DBGET integrated database retrieval system