KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10157Help
Entry
HMPREF0833_10157  CDS       T01545                                 

Definition
(GenBank) D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00473  D-Alanine metabolism
scp00550  Peptidoglycan biosynthesis
scp01100  Metabolic pathways
scp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF0833_10157
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0833_10157
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HMPREF0833_10157
Enzymes [BR:scp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HMPREF0833_10157
Peptidoglycan biosynthesis and degradation proteins [BR:scp01011]
 Precursor biosynthesis
  Amino acid ligase
   HMPREF0833_10157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AEH55188
UniProt: F8DFB3
LinkDB All DBs
Position
154005..155051
Genome map
AA seq 348 aa AA seqDB search
MSKQDLILLYGGRSAEREVSVLSAESVMRAIDYQAFSVQTYFITQSGDFIQTQAFEEKPA
DDEKLMTNDTVDWSKKVAPSAIYKEGAVVFPVLHGPMGEDGSIQGFLEVLKMPYVGCGIL
ASSVAMDKITTKRVLESAGIPQVPYVAVVEGDDLEEKIAAIEANLSYPVFTKPSNMGSSV
GISKSENQTELRTALELAFKYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAF
YDYDAKYIDNKITMAIPAQLDPEVVKTMRTNAEKAFRAIGGLGLARCDFFYTDKGEIFLN
ELNTMPGFTQWSMYPLLWDNMGLNYTDLITKLVELGKEVFQKHEAHLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaagacttaatcctgttgtatggtggacgtagtgcagaacgtgaagtttct
gttctttcagcagaaagcgtgatgcgcgcgattgattaccaagcattttcggttcaaacc
tactttattacgcagtcaggagacttcatccagacgcaagcttttgaagagaaaccagcg
gatgatgagaaattgatgaccaatgatacagtggactggtctaaaaaagtggcaccatct
gcgatttacaaggaaggagcagtggtctttccagttcttcatggaccaatgggagaagat
ggttccattcaaggcttcttagaagtcttgaagatgccttatgttggctgtggcatccta
gcttccagtgttgcgatggacaagatcacgaccaaacgggtcttggagtctgcagggatt
ccacaagttccttatgtagctgtagtggaaggcgatgacttggaagagaaaattgctgca
attgaagccaatctctcttatcctgtctttaccaaaccatccaatatgggctctagtgtt
gggatttcaaaatctgaaaaccaaacagaacttcggactgctcttgaattagcctttaaa
tacgatagccgtgtcttagtagagcaaggggttaatgcgcgtgagattgaagttggactg
cttggaaactatgatgtgaagagcaccttgccaggtgaagttgtgaaagatgtggccttc
tatgattatgatgccaaatacatcgacaacaaaattaccatggcgattccagctcaattg
gatcctgaggttgtgaaaaccatgcggaccaacgcagaaaaagcctttcgtgcaatcggt
ggtctgggcttggcgcgttgtgatttcttctatacagataaaggagagatcttcttaaac
gaactcaataccatgccaggatttacccaatggtctatgtatcctctgctttgggacaat
atgggactcaactatacagatttgattaccaagttagtagagcttggaaaagaagtcttc
caaaaacacgaagcgcatttgttgtaa

DBGET integrated database retrieval system