KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11097Help
Entry
HMPREF0833_11097  CDS       T01545                                 

Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00220  Arginine biosynthesis
scp00250  Alanine, aspartate and glutamate metabolism
scp00290  Valine, leucine and isoleucine biosynthesis
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01130  Biosynthesis of antibiotics
scp01210  2-Oxocarboxylic acid metabolism
scp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0833_11097
   00290 Valine, leucine and isoleucine biosynthesis
    HMPREF0833_11097
   00220 Arginine biosynthesis
    HMPREF0833_11097
Enzymes [BR:scp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HMPREF0833_11097
    2.6.1.66  valine---pyruvate transaminase
     HMPREF0833_11097
Amino acid related enzymes [BR:scp01007]
 Aminotransferase (transaminase)
  Class I
   HMPREF0833_11097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEH56128
UniProt: F8DJV8
LinkDB All DBs
Position
complement(1130498..1131712)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKIPNVDINDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEEANWYPDIEDIKSKITSNTKAIVVINPNNP
TGALYPDEILLEIVEIARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINDIPGLSAVKPKAGLYIFPKIDRDMYRVDDDEQFVLEFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatataataaatcaagcaaactcgaacatgtcgcttacgatattcgtggtcca
gtcttggaagaagcgatgcgcatgcgagcaaatggagaaaagattcttcgtttgaataca
ggaaatcctgctgaatttggctttacagctccagatgaagtcatccatgatctgatcatg
aatgcgcgtgatagtgaaggttattcggattcaaaagggatcttttcagcccgtaaggcc
atcatgcagtattgtcaattgaagaaaattccaaatgtcgatatcaatgatatttacctt
ggaaatggggtgagtgagctgatcgtcatgtccatgcaagggcttttggacaatggggat
gaagtattggtaccgatgccagactatcctctttggacggcggcagtcagcctagctggt
gggaacgcggttcactatctttgtgacgaagaagcaaactggtatccagatatcgaggat
atcaagtcgaaaattacctcgaataccaaggctatcgttgtcatcaacccgaataaccca
acaggtgccctctatccagatgagatcctgcttgagattgtagagatcgctcgtcaaaat
aacttgatcatctttgcggatgaaatttacgatcgtttggtcatggatggtgaaaaacat
acggctatcgcaagtttagcgcctgatctcttctgtgtgagtatgaatggcttgtcaaaa
tctcaccggattgccggtttccgtgttggttggatggttctatccggaccaaaacatcat
gtgaagggctatatcgaaggtttgaacatgttgtccaatatgcgtctttgttcaaatgtc
ttggctcaacaagttgtgcaaacctctcttggaggctatcaatccgtggatgaactcttg
cttccaggtggtcgaatctacgaacaacgcaactttatttacaaagctatcaatgatatt
ccaggcctctcagctgttaagcccaaagctggtctctatatcttccctaagattgatcgg
gacatgtatcgcgtggatgatgatgaacaatttgttttagagttcttgaaacaagaaaaa
attctcttggttcatggccgtggctttaattggaaggacccagatcacttccggatcgtt
tacctcccacgtgtggatgaattggctcaaattcaagaaaaaatgactcgtttcttgaaa
caatacaaacgctaa

DBGET integrated database retrieval system