KEGG   Stanieria cyanosphaera: Sta7437_0331Help
Entry
Sta7437_0331      CDS       T02406                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
scs  Stanieria cyanosphaera
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sta7437_0331
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sta7437_0331
Enzymes [BR:scs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Sta7437_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(368132..368467)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIAKQIDYMLEQGFIPGVEFEKEPTPELHHWTLWKLPL
FDARNAQDVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNSSRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaaaagagcgtcgttacgaaaccctttcttatttacctcctttaacc
gatcagcaaatcgccaaacaaatcgattatatgctcgagcaaggttttattcctggagtt
gagtttgaaaaagagcctactcctgaacttcaccactggactttgtggaaattacctttg
tttgatgctagaaacgctcaagatgtacttaatgaagttagagaatgtcgctctgaatat
tctgattgctacatccgcgtagttggttttgacaacattaagcaatgtcagactgttagc
tttattgtttacaaaccaaattctagtcgttactaa

DBGET integrated database retrieval system