KEGG   Stanieria cyanosphaera: Sta7437_1529Help
Entry
Sta7437_1529      CDS       T02406                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
scs  Stanieria cyanosphaera
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Sta7437_1529
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Sta7437_1529
Transporters [BR:scs02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Sta7437_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1710025..1710858
Genome map
AA seq 277 aa AA seqDB search
MTANLNNTVGKPNFFVSLIKNPPRKLLAPLCAILFILTLWQVLCSSPDANLPSPLKTFQD
TANLIFNPFFDNGGTDKGLFWQIIASLQRVAIGYTLAAVVGIGLGILIGSNAFMYDALDP
IFQVLRTVPPLAWLPIALAAFQEANPSAIFVIFITAIWPIIINTTVGVQQIPQDYKNVAK
VLRLSGTKYFWEIMFPAAVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGFFIWDSYNSS
QLSEIIVALIYVGLVGLLLDRLIAWIASVVVPSEQQQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacagctaatctaaacaataccgttgggaaacctaatttttttgtatctctgattaaa
aatccacctaggaaattactcgctcctctttgtgcaattctgtttattttgactctttgg
caggttttgtgtagtagtcccgatgctaatttaccgagtcctttaaaaacttttcaggat
acagctaatctaatttttaatcctttttttgataacggaggtacagacaaaggtttattt
tggcaaatcatagctagcttacaaagagtagcaattggttatactttggctgctgtagta
ggaattggattaggaattttaatcggttctaatgcttttatgtatgatgcattggatcct
atttttcaagtattaagaactgtaccgcctttagcttggttaccgatcgctttagctgcg
tttcaagaagctaatccttcggcaatttttgtgatttttattacggcaatttggccaatt
attattaatactacggtaggggtacagcaaatacctcaagattataaaaacgtagctaaa
gttttacgtttgtctggaactaagtatttttgggaaattatgttccctgctgccgttcct
tacatttttacaggtttaagaattgggattggtctttcttggttagcgatcgtagcagca
gaaatgttggttggtggtgtaggaattggtttctttatttgggactcttacaacagttct
caattaagtgaaattattgtggctttgatttatgtgggtttagttggtttactgcttgat
cgcttgattgcttggattgcttcagtcgtagttccttctgagcaacaacagtaa

DBGET integrated database retrieval system