KEGG   Stanieria cyanosphaera: Sta7437_3775Help
Entry
Sta7437_3775      CDS       T02406                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scs  Stanieria cyanosphaera
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sta7437_3775
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sta7437_3775
   00680 Methane metabolism
    Sta7437_3775
Enzymes [BR:scs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sta7437_3775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4270567..4273692
Genome map
AA seq 1041 aa AA seqDB search
MSSLLQSSSSEVTNISAAHLLLHGRLKLVEDLWESVLRSECGQEMVELLKKMRGLSSPEG
QATELPESSVLELVEKLNLNDAIQASRALALYFQLINIVEQHYEQKGQKVARRVTIEQLK
QNQNGNGESKANGNGNGNGNGTLSQVTASPIPGVNLLEDSWSQPEHHSNKAGTFHWLFPY
LQKLNMPPRVIQRLLDQLDIRLVFTAHPTEIVRHTIRKKQRRISRILEKLDLAEEALREI
SLTNSWEAEEATNQLMEEIRLWWRTDELHQFKPKVIDEVDYALHYFQEVLFDVVPQLSVR
LKQALRSTFPWLSPPRNNFCYFGSWVGADRDGNPFVTPQVTWETACYQRSLVLDRYIHSV
EQLRELLSLSLHWSNVLPDLLDSLEKDRLQIPEIYEQLAIRYRQEPYRLKLTYIEQRLKN
TRDRNLALSRADVTQNITELANNIYRSGEEFLAELQLIQKSLAETKLHCRELDNLICQVE
VYGFYLAQLDFRQESSRHAEAIEEIAEYLNILPKPYSQLSETEKTTWLIEELKTRRPLIP
AEMPFSETTCETIKTLRMLRQLQQEFGVGICQTYIISMTNHVSDVLEVMLLAQEAGLYDP
ATSQITLRIVPLFETVDDLKRAPEVMRALFELPLYRAALAGGYHCLTNSEGKLVEAKLCR
PTLEPTNLQEVMLGYSDSNKDSGFLSSNWEIHKAQKSLQKVASEYGVSLRLFHGRGGSVG
RGGGPAYAAILAQPTDTIKGRIKITEQGEVLASKYSLPELALYNLETITTAVIQSSLLGS
GFDRVEPWNEIMEELATRSRSAYRSLVYEQPDFVDFFMSVTPIEVISQLQIGSRPSKRPP
GNLKTDNQEQAKKRNISSLRAIPWVFSWTQSRFLLPAWYGVGTALQEFLEQEPEKNLNLL
RYFYFKWPFFKMVISKVEMTLAKVDLQIAEHYVRELSKPEDLDRFERLFEQIAQEYYLTK
QLVLTVNGQTKLLDNDPELQRSVQLRNGTIVPLGFLQVSLIKRLRQYEESNVVHFRFSKE
ELLRGAMLTINGIAAGMRNTG
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcttctccaatcttcttcgtcagaagttactaacatttcagccgctcatcta
ctactccatggtcgacttaagctagtagaagatttgtgggagtcagtcttgcgctccgaa
tgtggacaggagatggtcgaactactcaaaaaaatgcgcggtctgtcttctcctgaagga
caagcgactgagttacctgaatcgtccgtacttgagctagtagaaaaacttaatttgaat
gatgcaattcaagcttctcgtgctttagctctttattttcaattaatcaatattgttgaa
cagcattacgaacaaaagggacaaaaagttgccagaagagtcacaattgaacagttaaag
caaaatcaaaatggcaatggtgagagtaaagcaaacggcaatggcaatggcaatggcaat
ggtactctttctcaagttactgcttctcccattcctggtgtaaatctacttgaagatagt
tggtctcaaccagagcatcattcaaataaagcagggacatttcactggttgtttccctat
ttgcaaaaacttaatatgcctcctcgggtcatacaaagactattagatcaattagatatt
cgtttagtttttactgctcaccctactgaaatagttcgtcataccattcgtaaaaaacaa
cgacgcatctctcgaattctagaaaaattggatttagctgaagaagctttgcgcgaaatt
agtttgactaattcttgggaagctgaagaagcaactaatcaattaatggaagaaattcga
ttgtggtggcgtactgatgaattgcatcaattcaaaccgaaagtaattgacgaagtagat
tatgctcttcattatttccaagaagttttatttgatgttgtcccacagctttctgttcgc
ctaaaacaagctcttcgtagtacttttccttggctgagtccaccacgcaataatttttgt
tattttggttcttgggtaggagctgatcgcgatggcaatccttttgtaacaccacaagtt
acttgggaaacagcttgttatcaaagaagtttagttttagatcgttatattcattcggta
gaacaactgcgagaattattaagtttgtctcttcactggagtaacgtattaccagattta
ctcgattctttagaaaaagaccgactgcaaattcctgaaatttatgaacaattagctatt
cgttatcgtcaagaaccctatcgtctcaaattaacttatatcgaacagcgattaaaaaat
actcgcgatcgcaacttagcattatctcgtgccgatgttactcaaaatattacagaatta
gctaacaatatttatagatcgggagaagagtttctcgcagaattacaactaattcaaaag
agtttggcagaaacaaaattacactgtcgcgaactggataatttaatttgtcaggtagaa
gtttatggcttttatttagctcagttagattttcgccaagaatcttctcgtcatgccgaa
gcgattgaagaaattgccgaatatctcaatattttacctaaaccttacagtcaactctca
gaaacagaaaaaacgacttggttaattgaggaattaaaaactcgtcgtcctctaattcca
gcagaaatgcctttttcggaaacaacttgcgaaacaatcaaaactctgcggatgttacga
caattacagcaagagtttggtgtaggcatttgtcaaacttatattatcagcatgactaat
catgttagtgatgtgttggaagtcatgttgttagcacaagaagcaggattatacgaccct
gctacaagtcagattaccctaagaattgtgcctttatttgaaactgtagatgacctcaaa
cgtgcgccagaggtaatgagagctttatttgaactgcctttatatcgagcagctttagca
ggaggataccactgcttaaccaactctgaaggcaaactcgttgaagcaaaattatgccga
cctactcttgaaccgactaatttacaagaggtaatgttgggttactccgatagtaataaa
gattcggggtttttgagtagtaattgggaaattcataaagcacaaaaaagtttacaaaaa
gttgcttctgaatatggggtttctttacgacttttccatggtcgtggtggttctgtaggt
cgtggcggtggtcctgcttatgctgcaatcttggcacaaccaactgatacgatcaaaggc
agaatcaaaattactgaacaaggagaggttttagcttctaagtattctttaccagaatta
gctctatataatttagaaactattactactgcggtaattcaatctagcttgcttggaagt
ggttttgatcgggttgaaccttggaatgaaatcatggaagagttggcaactcgttctcgg
agtgcttatcgttcgctagtttacgaacagccagattttgttgatttctttatgtctgtc
acgccaattgaggtcattagtcaattacagattggttcacgtccttctaaacgtcctcct
ggtaatcttaagacagataatcaggaacaagctaagaaaagaaatataagtagtttgaga
gcaattccttgggtatttagttggacgcaaagtcgttttctcctgcctgcttggtatgga
gttggtacagcactacaagaatttctcgaacaagaacctgagaagaatttgaatctgttg
cgctatttttactttaagtggcctttctttaaaatggttatttctaaagtagaaatgact
ttagcaaaagttgacttacaaatcgctgaacattatgtaagagaactttctaaaccagaa
gatttagatcgttttgaacgattgtttgagcaaattgcccaagaatattatttgacgaaa
caattggttttgacagttaatggtcaaactaaactgttggataatgatccagaattacaa
cgttcagttcaattgcgaaatggtacaattgttcctcttggtttcttacaggtttcttta
atcaaaagactacggcaatatgaagaatccaatgtagttcacttccgctttagtaaggaa
gagttactcagaggtgcaatgttgacgatcaatggaattgctgcgggaatgcgtaatacc
ggttga

DBGET integrated database retrieval system