KEGG   Stanieria cyanosphaera: Sta7437_3775Help
Entry
Sta7437_3775      CDS       T02406                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00620  Pyruvate metabolism
scs00680  Methane metabolism
scs00710  Carbon fixation in photosynthetic organisms
scs01100  Metabolic pathways
scs01120  Microbial metabolism in diverse environments
scs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sta7437_3775
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sta7437_3775
   00680 Methane metabolism
    Sta7437_3775
Enzymes [BR:scs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sta7437_3775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DnaGprimase_HBD
Motif
Other DBs
NCBI-ProteinID: AFZ37267
UniProt: K9XZZ9
LinkDB All DBs
Position
4270567..4273692
Genome map
AA seq 1041 aa AA seqDB search
MSSLLQSSSSEVTNISAAHLLLHGRLKLVEDLWESVLRSECGQEMVELLKKMRGLSSPEG
QATELPESSVLELVEKLNLNDAIQASRALALYFQLINIVEQHYEQKGQKVARRVTIEQLK
QNQNGNGESKANGNGNGNGNGTLSQVTASPIPGVNLLEDSWSQPEHHSNKAGTFHWLFPY
LQKLNMPPRVIQRLLDQLDIRLVFTAHPTEIVRHTIRKKQRRISRILEKLDLAEEALREI
SLTNSWEAEEATNQLMEEIRLWWRTDELHQFKPKVIDEVDYALHYFQEVLFDVVPQLSVR
LKQALRSTFPWLSPPRNNFCYFGSWVGADRDGNPFVTPQVTWETACYQRSLVLDRYIHSV
EQLRELLSLSLHWSNVLPDLLDSLEKDRLQIPEIYEQLAIRYRQEPYRLKLTYIEQRLKN
TRDRNLALSRADVTQNITELANNIYRSGEEFLAELQLIQKSLAETKLHCRELDNLICQVE
VYGFYLAQLDFRQESSRHAEAIEEIAEYLNILPKPYSQLSETEKTTWLIEELKTRRPLIP
AEMPFSETTCETIKTLRMLRQLQQEFGVGICQTYIISMTNHVSDVLEVMLLAQEAGLYDP
ATSQITLRIVPLFETVDDLKRAPEVMRALFELPLYRAALAGGYHCLTNSEGKLVEAKLCR
PTLEPTNLQEVMLGYSDSNKDSGFLSSNWEIHKAQKSLQKVASEYGVSLRLFHGRGGSVG
RGGGPAYAAILAQPTDTIKGRIKITEQGEVLASKYSLPELALYNLETITTAVIQSSLLGS
GFDRVEPWNEIMEELATRSRSAYRSLVYEQPDFVDFFMSVTPIEVISQLQIGSRPSKRPP
GNLKTDNQEQAKKRNISSLRAIPWVFSWTQSRFLLPAWYGVGTALQEFLEQEPEKNLNLL
RYFYFKWPFFKMVISKVEMTLAKVDLQIAEHYVRELSKPEDLDRFERLFEQIAQEYYLTK
QLVLTVNGQTKLLDNDPELQRSVQLRNGTIVPLGFLQVSLIKRLRQYEESNVVHFRFSKE
ELLRGAMLTINGIAAGMRNTG
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcttctccaatcttcttcgtcagaagttactaacatttcagccgctcatcta
ctactccatggtcgacttaagctagtagaagatttgtgggagtcagtcttgcgctccgaa
tgtggacaggagatggtcgaactactcaaaaaaatgcgcggtctgtcttctcctgaagga
caagcgactgagttacctgaatcgtccgtacttgagctagtagaaaaacttaatttgaat
gatgcaattcaagcttctcgtgctttagctctttattttcaattaatcaatattgttgaa
cagcattacgaacaaaagggacaaaaagttgccagaagagtcacaattgaacagttaaag
caaaatcaaaatggcaatggtgagagtaaagcaaacggcaatggcaatggcaatggcaat
ggtactctttctcaagttactgcttctcccattcctggtgtaaatctacttgaagatagt
tggtctcaaccagagcatcattcaaataaagcagggacatttcactggttgtttccctat
ttgcaaaaacttaatatgcctcctcgggtcatacaaagactattagatcaattagatatt
cgtttagtttttactgctcaccctactgaaatagttcgtcataccattcgtaaaaaacaa
cgacgcatctctcgaattctagaaaaattggatttagctgaagaagctttgcgcgaaatt
agtttgactaattcttgggaagctgaagaagcaactaatcaattaatggaagaaattcga
ttgtggtggcgtactgatgaattgcatcaattcaaaccgaaagtaattgacgaagtagat
tatgctcttcattatttccaagaagttttatttgatgttgtcccacagctttctgttcgc
ctaaaacaagctcttcgtagtacttttccttggctgagtccaccacgcaataatttttgt
tattttggttcttgggtaggagctgatcgcgatggcaatccttttgtaacaccacaagtt
acttgggaaacagcttgttatcaaagaagtttagttttagatcgttatattcattcggta
gaacaactgcgagaattattaagtttgtctcttcactggagtaacgtattaccagattta
ctcgattctttagaaaaagaccgactgcaaattcctgaaatttatgaacaattagctatt
cgttatcgtcaagaaccctatcgtctcaaattaacttatatcgaacagcgattaaaaaat
actcgcgatcgcaacttagcattatctcgtgccgatgttactcaaaatattacagaatta
gctaacaatatttatagatcgggagaagagtttctcgcagaattacaactaattcaaaag
agtttggcagaaacaaaattacactgtcgcgaactggataatttaatttgtcaggtagaa
gtttatggcttttatttagctcagttagattttcgccaagaatcttctcgtcatgccgaa
gcgattgaagaaattgccgaatatctcaatattttacctaaaccttacagtcaactctca
gaaacagaaaaaacgacttggttaattgaggaattaaaaactcgtcgtcctctaattcca
gcagaaatgcctttttcggaaacaacttgcgaaacaatcaaaactctgcggatgttacga
caattacagcaagagtttggtgtaggcatttgtcaaacttatattatcagcatgactaat
catgttagtgatgtgttggaagtcatgttgttagcacaagaagcaggattatacgaccct
gctacaagtcagattaccctaagaattgtgcctttatttgaaactgtagatgacctcaaa
cgtgcgccagaggtaatgagagctttatttgaactgcctttatatcgagcagctttagca
ggaggataccactgcttaaccaactctgaaggcaaactcgttgaagcaaaattatgccga
cctactcttgaaccgactaatttacaagaggtaatgttgggttactccgatagtaataaa
gattcggggtttttgagtagtaattgggaaattcataaagcacaaaaaagtttacaaaaa
gttgcttctgaatatggggtttctttacgacttttccatggtcgtggtggttctgtaggt
cgtggcggtggtcctgcttatgctgcaatcttggcacaaccaactgatacgatcaaaggc
agaatcaaaattactgaacaaggagaggttttagcttctaagtattctttaccagaatta
gctctatataatttagaaactattactactgcggtaattcaatctagcttgcttggaagt
ggttttgatcgggttgaaccttggaatgaaatcatggaagagttggcaactcgttctcgg
agtgcttatcgttcgctagtttacgaacagccagattttgttgatttctttatgtctgtc
acgccaattgaggtcattagtcaattacagattggttcacgtccttctaaacgtcctcct
ggtaatcttaagacagataatcaggaacaagctaagaaaagaaatataagtagtttgaga
gcaattccttgggtatttagttggacgcaaagtcgttttctcctgcctgcttggtatgga
gttggtacagcactacaagaatttctcgaacaagaacctgagaagaatttgaatctgttg
cgctatttttactttaagtggcctttctttaaaatggttatttctaaagtagaaatgact
ttagcaaaagttgacttacaaatcgctgaacattatgtaagagaactttctaaaccagaa
gatttagatcgttttgaacgattgtttgagcaaattgcccaagaatattatttgacgaaa
caattggttttgacagttaatggtcaaactaaactgttggataatgatccagaattacaa
cgttcagttcaattgcgaaatggtacaattgttcctcttggtttcttacaggtttcttta
atcaaaagactacggcaatatgaagaatccaatgtagttcacttccgctttagtaaggaa
gagttactcagaggtgcaatgttgacgatcaatggaattgctgcgggaatgcgtaatacc
ggttga

DBGET integrated database retrieval system