KEGG   Stanieria cyanosphaera: Sta7437_4025Help
Entry
Sta7437_4025      CDS       T02406                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
scs  Stanieria cyanosphaera
Brite
Enzymes [BR:scs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sta7437_4025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFZ37503
UniProt: K9XY88
LinkDB All DBs
Position
4517428..4518027
Genome map
AA seq 199 aa AA seqDB search
MAYELPSLPYDYTALEPYISKSTLEFHHDKHHAAYVNKYNDAVKGTELDSKSIEEVIKAI
AGDSSKTGLFNNAAQAWNHTFYWQCMKPNGGGTPTRELAKKIEADFGGFDQFVEAFKDAG
ATQFGSGWAWLVLDGDKLKVTKTLNADNPLTSGQVPLLTMDVWEHAYYLDYQNKRPSYID
EFVAHLINWDFVAQNLSAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaattaccatctcttccctatgactacacagctttagaaccgtatatttcc
aaaagcactttagaatttcatcatgataaacatcatgctgcgtatgttaataagtacaat
gatgcagtcaaaggaactgaacttgatagtaaatcgattgaagaagtaattaaagcgatc
gcaggagattctagtaaaacaggacttttcaataacgctgcccaagcttggaatcatact
ttttattggcaatgtatgaaacctaatggtggcggtactcccacacgagaattagctaaa
aaaattgaagctgattttggtggtttcgatcagtttgttgaagcttttaaagatgcaggt
gcaactcaatttggtagtggttgggcttggttagtcttagatggagataagctcaaagtt
accaaaactttaaatgctgataatcctttgactagtggacaagttcctttactaactatg
gacgtttgggaacacgcttattatctcgattaccaaaacaaacgaccatcttacattgat
gagtttgtcgctcatttaatcaactgggactttgtagctcaaaatttgtctgctgcgtag

DBGET integrated database retrieval system