KEGG   Sorangium cellulosum So0157-2: SCE1572_15135Help
Entry
SCE1572_15135     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
Organism
scu  Sorangium cellulosum So0157-2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4233310..4235079)
Genome map
AA seq 589 aa AA seqDB search
MHADRAITFMRSSGEERSVSYAELWLEARRRAHALRKLGLKKGDRVALILAEADEFVLTF
VGALTAGIVAVPMYPPQSLAKLEAYSETVQHILAASGARVLVTNEPLKEMIDAHLAASGD
GPAALRVVLERDLREPEGFDASDAAEPWRVSLDDLAFLQFTSGSTSRPKGVMVTHRNLTV
NSHAIMFDGLRSTPEDRGVSWLPLYHDMGLIGFVIAPLYALVPVLFLPTTAFIRRPSLWL
DAIHRFRGTITFAPNFAFALATRAVTEAQAGQWDLSCLRALGCGAEPIQADVLRAFLDRF
GKHGLRPESILPSYGMAEATLAITFSDLAARLTTDRVDAKAMQSGKARPANGGASMELVS
CGRPLPCHQLIIAGPDGAPLGEREVGEIWVRGPSVAAGYFNEPDATKAAFGGGWLRTGDL
GYTVAGEVYLCGRSKDLIILGGKNYFPQDIERVASSVEGVREGHCVAFSCLTASGAERAV
VVAEVKRGVAGVAQAILQAVRAQLGVQLSEVALIKRGTLAKTSSGKVRRREMKRRFEAGE
LEVASDVDEGVTPSPQADAVRASGAAARTEGGRAGGAPARVEGVIDGIQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgccgaccgagcgatcacgttcatgcgcagctcgggagaggagcggtcggtcagc
tacgccgagctctggctcgaggcgcggcgcagggcccacgcgctgcgcaagctcgggctc
aagaagggcgaccgcgtcgccctgatcctggccgaggccgacgagttcgtcctgaccttc
gtgggcgcgctcacggccggcatcgtcgcggtcccgatgtatccgccgcagtcgctggcc
aagctcgaggcatacagcgagacggtgcagcacatcctcgccgcctccggcgcgcgcgtg
ctcgtcacgaacgagccgctcaaggagatgatcgacgcccacctcgccgcgagcggcgac
ggcccggccgccctgcgcgtcgtcctggagcgcgatctgcgcgagcccgaggggttcgac
gcgtcggacgcggcggagccgtggcgggtgtccctcgacgacctcgcgttcctgcagttc
acgtcggggagcacctcgcggcccaagggcgtgatggtgacccaccgcaacctgacggtg
aacagccacgcgatcatgttcgacgggctgcgctccaccccggaagatcgcggggtcagc
tggctgccgctctaccacgacatggggctcatcggcttcgtcatcgcgccgctctacgcg
ctcgtgccggtgctgttcctgccgacgacggcgttcatccgccgcccctcgctctggctc
gacgcgatccacaggttccgcggcacgatcacgttcgccccgaacttcgccttcgccctg
gcgacgcgcgccgtcaccgaggcgcaggcgggccagtgggatctctcctgcctgcgcgcg
ctcgggtgcggggccgagccgatccaggccgacgtgctccgcgcgttcctcgatcgcttc
ggcaagcatgggctccgcccggagagcatcctgccgtcgtacggcatggccgaggccacg
ctggcgatcaccttcagcgacctcgcggcccggctcaccaccgaccgggtggacgcgaag
gcgatgcagtccggcaaggcgcggcccgcgaacggcggcgcgtcgatggagctcgtctcc
tgcggccgccccctcccctgccaccagctcatcatcgcggggcccgacggcgcgccgctc
ggcgagcgcgaggtgggcgagatctgggtgcgcggcccgagcgtcgccgccgggtacttc
aacgagccggacgcgacgaaggccgcgttcggagggggctggctgcggacaggcgatctc
ggctataccgtcgccggcgaggtgtacctctgcggccgctcgaaggatctcatcatcctc
ggcggcaagaactacttcccccaggacatcgagcgcgtcgcctcctccgtggagggggtg
cgcgagggccactgcgtcgcgttctcgtgcctcacggcgtcgggggccgagcgggcggtc
gtcgtcgccgaggtcaagcgcggcgtggccggcgtggcgcaggcgatcctccaggcggtg
cgcgctcagctcggcgtccagctgtccgaggtcgcgctcatcaagcgggggacgctggcc
aagacgtcgagcggcaaggtgcggcgccgcgagatgaagcggcgcttcgaggccggcgag
ctcgaggtcgcctcggacgttgacgagggcgtcacgccctccccccaagccgacgcggtc
cgcgcgagcggagcggcggcgcgaaccgaagggggccgcgcgggcggcgccccggcacgt
gtcgaaggagtcatcgatgggatccagtaa

DBGET integrated database retrieval system