KEGG   Streptomyces sp. CdTB01: AS200_09235Help
Entry
AS200_09235       CDS       T04240                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
scx  Streptomyces sp. CdTB01
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2088929..2089945)
Genome map
AA seq 338 aa AA seqDB search
MGEAVELEAGGRTVRLSSPDKVFFPERGFTKLDLARYYIAVGPGILRALRDRPTTLERYP
DGVTGESFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEEAAVLWAAQFGTLTFHPWP
VRRDDVDRPDELRIDLDPQPCTDYDDAVHAAHELRAVLDEFGGLKGFPKTSGGRGLHVFV
PIEPRWTFTQVRRAAIAVGREMERRMPDRVTIKWWKEERGERIFLDYNQTARDRTIASAY
SVRPRPHAPVSAPLRWDEVGVARPQDFDIATMPARFAELGDVHADMDDHRYSLDALLDLA
RRDEHDHGLGDLPYPPEYPKMPGEPRRVQPSRARKDPS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagcggtggaactggaagcgggcggccgtacggtccggctgtccagcccggac
aaggtcttcttcccggagcgcggattcaccaagctggacctcgcccggtactacatcgcc
gtgggccccggcatcctgcgcgccctgcgcgaccggcccaccaccctggagcgctacccg
gacggcgtcaccggcgagtccttcttccagaagcgggcgcccaagaacatgcccgactgg
atcccgaccgcccacatcaccttccccagcggccgcagcgccgacgagatgtgccccacg
gaggaggccgccgtcctgtgggcggcccagttcggcacgctcaccttccacccgtggccg
gtacgccgcgacgacgtcgaccgccccgacgaactgcgcatcgacctcgacccgcagccc
tgcaccgactacgacgacgccgtgcacgccgcccacgaactgcgcgccgtcctcgacgag
ttcggcggcctcaagggcttcccgaagacctccggcggacgcggcctgcacgtcttcgtg
ccgatcgaaccccgctggaccttcacccaggtgcgccgcgccgccatcgccgtgggccgc
gagatggagcgcaggatgccggaccgcgtgaccatcaagtggtggaaggaggagcgcggc
gagcgcatcttcctcgactacaaccagacggcacgcgaccgcaccatcgcctccgcctac
tccgtacggccccgcccgcacgcccccgtctcggcgcccctgcgctgggacgaggtcggc
gtcgcgcgtccgcaggacttcgacatcgccaccatgcccgcgcgcttcgccgaactcggc
gacgtgcacgccgacatggacgaccaccgctactccctcgacgccctgctggacctcgcg
cgccgggacgagcacgatcacgggctcggcgatctcccctacccgcccgagtaccccaag
atgccgggggagcccaggcgggtgcagcccagccgggcgcggaaggacccctcctga

DBGET integrated database retrieval system