KEGG   Streptomyces sp. CdTB01: AS200_13785Help
Entry
AS200_13785       CDS       T04240                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
scx  Streptomyces sp. CdTB01
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AS200_13785
   00650 Butanoate metabolism
    AS200_13785
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS200_13785
   00280 Valine, leucine and isoleucine degradation
    AS200_13785
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS200_13785
Enzymes [BR:scx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AS200_13785
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AS200_13785
Amino acid related enzymes [BR:scx01007]
 Aminotransferase (transaminase)
  Class III
   AS200_13785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3168484..3169818
Genome map
AA seq 444 aa AA seqDB search
MSALPQERRVVTAIPGPKSQELQARRTAAVAQGVGSVLPVFTARAGGGIIEDVDGNRLID
FGSGIAVTSVGASAEAVVRRASAQLADFTHTCFMVTPYEGYVAVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGFGPFAPE
VYRVPVAYGYRWPTGPENAGPEAAAQAIDQITKQVGPENVAAIIIEPVLGEGGFIEPAKG
FLPAISKFASDNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDAAHAGGLGGTYGGNPVACAGALGAIETMKELDLNARAKDIEAVMKARLTAMAE
KFDVIGDVRGRGAMIAIELVKDRATKEPNPEATAALAKACHQEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFARI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacttccgcaggagcgccgcgtcgtcaccgccatccccggcccgaagtcgcag
gagctgcaggcccgccgtaccgccgcggtcgcgcagggcgtgggctccgtgctgcccgtc
ttcaccgcgcgcgcgggcggcgggatcatcgaggacgtcgacggcaaccgcctgatcgac
ttcggttccggcatcgccgtgacgagcgtgggcgcctccgccgaggccgtcgtacgccgg
gcgtccgcgcagctcgcggacttcacccacacctgtttcatggtcaccccgtacgagggc
tacgtggcggtcgccgaggcgctcgccgagctcaccccgggtgaccacgcgaagaagtcg
gcgctgttcaactccggcgccgaggccgtcgagaacgccgtcaagatcgcccgcgcgtac
accaagcgccaggcggtcgtcgtgttcgaccacggctaccacggccgcaccaacctcacg
atggcgctgacggcgaagaacatgccgtacaagcacggcttcggtccgttcgcgcccgag
gtgtaccgcgtccccgtggcctacggctaccgctggcccaccggcccggagaacgccggc
cccgaggccgccgcgcaggccatcgaccagatcaccaagcaggtcggcccggagaacgtg
gccgcgatcatcatcgagccggtgctcggcgagggcggcttcatcgagcccgccaagggc
ttcctgccggcgatcagcaagttcgcctcggacaacggcatcgtcttcgtcgccgacgag
atccagtccggcttctgccgcaccggccagtggttcgcgtgcgaggacgagggcatcgtc
ccggacctgatcaccaccgccaagggcatcgcgggcggtctgccgctcgccgccgtcacc
ggccgcgccgagatcatggacgccgcgcacgcgggcggcctgggcggcacctacggcggc
aacccggtggcctgcgccggtgcgctcggcgccatcgagaccatgaaggagctcgacctc
aacgcccgggcgaaggacatcgaggcggtcatgaaggcacggctgaccgcgatggccgag
aagttcgacgtcatcggcgacgtccgcggccgcggcgcgatgatcgcgatcgagctggtc
aaggaccgcgcgaccaaggagccgaacccggaggcgaccgccgcgctggcgaaggcctgc
caccaggagggcctgctggtcctgacctgtggcacctacggcaacgtgctccgcttcctg
cccccgctggtcatcggcgaggacctcctcaacgagggcctcgacatcatcgagcaggcg
ttcgcacgcatctga

DBGET integrated database retrieval system