KEGG   Streptomyces sp. CdTB01: AS200_15915Help
Entry
AS200_15915       CDS       T04240                                 

Definition
(GenBank) hypothetical protein
Organism
scx  Streptomyces sp. CdTB01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 GerE TPR_2 TPR_12 TPR_16 DUF2791 AAA_22 TPR_1 Sigma70_r4_2 TPR_10 Zeta_toxin DUF3856 Sigma70_r4 HTH_24 TniB IstB_IS21 HTH_28 AAA_30 HTH_23 AAA_5 TPR_7 TPR_8 NACHT TPR_4
Motif
Other DBs
NCBI-ProteinID: ALV33350
UniProt: A0A0U3PHW0
LinkDB All DBs
Position
complement(3614452..3617484)
Genome map
AA seq 1010 aa AA seqDB search
MLASVETRSVSPVFVGRAEELDTLNDALARAAAGEPQALLIGGEAGVGKTRLVEEFATAA
CRRGAVVALGGCVEIGADGLPFAPFSTALRALRRELPAEVAAAAAGQEDELTRLLPELGE
TGSGRHDEEGMARLFELTARLLERVAADRTVVVALEDLHWADASTRHLLAYLLRTLRSGR
LVVLATYRADDIHRRHPLRPLLAELDRLRTVRRIELARFTRTEVGRQLAGILAAEPDPGQ
VEEIFERSDGNAFFVEELAVCATEGCGTGLTDSLRDLLLVRVEGMPESAQRIARIVAEGG
STVEYRLLSAVAGLAEDDLIEALRAAVNANILIATPAGDGYRFRHSLVREAVGDDLLPGE
RSRLNRRYAEALEADPTLVPAEERVMRLASYWYHAHAPAKALPAVLDASVEARRRHAYSE
QLRLLERAMELWDTTPEAVRDELRPIDYTEVYPPCGCDPATTPLRYLDLMAEAAVAGRLS
GERERALKITKRALHLLEDEDDPLRAAWFWTQRAVMVQNLARGDGWKELATAQELVRGLP
PSEVHAEVLTQVAGWSMLRAPGPQALSDAERAVEYARMVGARETEMNARLTLGTLMVDAG
DVEAGLAVMSEVKDQARQDGIASVAGRAHVNLPSELEAVGRSREAVGVLEEGTAYARRYG
LLNTEAWVWSNLSDSLYSLGRWDEAVEAAEKALRRGQSAKPQGAAAMKLAQVALGRGDVA
EAARQRDAAERYFGSHDPMPQQSLPLAALTVGVAAAEGRLLDVRAEVRRSLDGGVPPGTQ
RYVWPLLLGAAIAEAESRALPAAGQGRGEALGVLFEAAKRLTTVAPVWLAHERWVRAELA
RAEGRDTADTWSEVVTAFESVERPYDLARVRHRLAAALLGAGGDDERDRATELLRLAHAV
AGHLGARPLGDAVALLAQRARLPLTRVPEQRPADPAEALGLTSRERDVLRLVAAGRTNRQ
IAEELFISPKTASVHVSNILGKLGVSGRGEAAATAHRLGLYAADALDPAR
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgtccgtggagaccaggtccgtcagtcccgtcttcgtcggccgagccgaagaa
ctggacacgctgaacgacgccctcgcccgagccgccgcgggcgagccgcaggcgctgctg
atcggcggcgaggccggcgtcggcaagaccaggctcgtcgaggagttcgccaccgcggcc
tgccgccgcggcgccgtcgtcgccctcggcggctgcgtcgagatcggcgccgacggactg
cccttcgccccgttctccaccgccctgcgcgccctgcgccgcgaactgcccgccgaagtc
gccgccgcggccgccggccaggaggacgagctcaccaggctgctgcccgaactgggcgag
accggctccggacgccacgacgaggagggcatggcccgcctcttcgaactcaccgcccgc
ctcctggaacgcgtcgccgccgaccgcacggtcgtcgtcgccctggaggacctgcactgg
gcggacgcctccacccgccacctcctcgcctacctcctgcgcaccctgcgctccggccgc
ctggtcgtcctcgccacctaccgcgccgacgacatccaccgccgccacccgctgcgcccc
ctgctcgccgaactcgaccgcctgcgcacggtccgccgcatcgaactggcccgcttcacc
cgcaccgaggtcggccgccagctcgccggcatcctcgccgccgaaccggaccccggccag
gtcgaggagatcttcgaacgctccgacggcaacgccttcttcgtcgaggagctcgccgtc
tgcgccaccgagggctgcggcaccggcctcaccgactccctgcgcgacctgctcctggtc
cgcgtcgagggcatgcccgagagcgcccagcgcatcgcccggatcgtcgccgagggcggc
tccaccgtggagtaccggctgctctcggccgtcgccgggctcgccgaggacgacctcatc
gaggcgctgcgggccgcggtgaacgccaacatcctcattgccacccccgcgggcgacggc
taccgcttccgccactccctggtccgcgaggccgtcggcgacgacctgctgcccggtgag
cgctcccgcctcaaccgccgctacgccgaagccctggaggccgacccgacgctcgtcccc
gccgaggaacgcgtcatgcgcctggccagctactggtaccacgcccacgcgccggccaag
gcactccccgccgtcctcgacgcctccgtcgaggcccggcgccgccacgcctacagcgag
caactgcgcctgctggaacgggcgatggagctgtgggacaccacccccgaggcggtccgg
gacgaactgcgccccatcgactacaccgaggtctatccgccctgcggctgcgaccccgcc
accaccccgctgcgctacctcgacctgatggccgaggccgccgtcgccggccggctctcc
ggggaacgcgaacgcgccctgaagatcaccaaacgcgcgctgcacctgctggaggacgag
gacgatccgctgcgcgccgcctggttctggacccagcgcgcggtgatggtgcagaacctc
gcccgcggcgacggctggaaggaactggccaccgcccaggagctggtgcgcggcctgccg
ccctccgaggtgcacgccgaggtgctcacccaggtcgccggctggtcgatgctgcgcgcc
cccggccctcaggctctgtccgacgccgaacgcgccgtggagtacgcgcgcatggtgggc
gcccgggagacggagatgaacgcccgcctcaccctcggcaccctgatggtcgacgcgggg
gacgtcgaggcgggcctcgccgtgatgagcgaggtcaaggaccaggcccggcaggacggc
atcgcctccgtcgccggccgcgcccacgtcaacctgccctccgagctggaggcggtggga
cgctcgcgcgaggccgtcggcgtcctcgaggagggcaccgcctacgcgcgccgctacggc
ctgctgaacaccgaggcgtgggtgtggtccaacctctccgactccctgtactcactgggc
cgttgggacgaggcggtggaggcggcggagaaggcgctgcggcgcgggcagagcgccaaa
ccgcagggcgcggccgcgatgaaactcgcccaggtagccctgggcaggggcgacgtggcg
gaggccgcccgtcaacgggacgccgccgaacggtacttcggcagccacgaccccatgccg
cagcagtcactgcccctggccgccctcaccgtcggtgtcgccgcggccgagggccgtctc
ctcgacgtccgcgccgaggtgcggcgcagcctggacggcggcgtcccgcccggcacccag
cgctacgtctggccgctgctgctcggcgccgcgatcgccgaggccgagtcccgcgcgctg
cccgcggccgggcagggccgtggcgaggccctcggcgtgctcttcgaggccgccaagcgg
ctcaccaccgtggcccccgtctggctcgcccacgagcggtgggtccgggccgaactcgcc
cgcgcagaaggccgggacaccgcggacacctggtcggaggtggtcaccgccttcgagagc
gtcgagcgcccctacgacctcgcccgcgtccgtcaccgcctggccgcggccctgctcggc
gcgggcggcgacgacgaacgcgaccgggccacggagctgctgcgcctggcccacgccgtg
gccggccatctcggtgcccgcccgctcggcgacgccgtcgccctcctcgcccagcgggcc
cgcctgcccctgacccgcgtcccggagcagcggcccgccgacccggccgaggccctcggg
ctgaccagccgcgaacgcgacgtgctgcggctcgtcgccgcaggccgcaccaaccgccag
atcgccgaggagctcttcatctcgccgaagacggccagcgtccatgtgtcgaacattctg
ggcaagctcggcgtctcaggacggggggaggcggcggcgacggcccaccggctcgggctg
tacgcggccgacgcgctcgacccggcccggtga

DBGET integrated database retrieval system