KEGG   Streptomyces sp. CdTB01: AS200_22490Help
Entry
AS200_22490       CDS       T04240                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00380  Tryptophan metabolism
scx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scx00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AS200_22490
Enzymes [BR:scx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AS200_22490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Glyoxalase_3
Motif
Other DBs
NCBI-ProteinID: ALV34512
UniProt: A0A0U3NXU4
LinkDB All DBs
Position
complement(5043902..5045089)
Genome map
AA seq 395 aa AA seqDB search
MSELASRATELDAADELAGLRERFVLDDVVYLDGNSLGALPAHVPGRVEDVVRRQWGELR
IRSWDESGWWTAPERIGDRIAPLVGAAAGQIVVGDSTSVNVFKALVAAVRMAGEGRDEIL
VDATTFPTDGYIAESAARMTGCTLRPVAPAEAGAALSGRTAAVLLNHVDYRTGRLYDLPA
LTTAVHAAGAIAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGAPAYLYVRRDLQ
DRFDSPLPGWNSHAEPFGMRPGYEPASGAVRGRVGTPDILSMLALEAALDVWDGVSVEAV
RAKSLALTDFFLECVAAYTPAGRVESVTPAAHAERGSQVALRCDDAGEVMERLIERGVVG
DFRHPDVLRFGFTPLYVGFADVERAARVLGETVAG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactggcctcccgagcaacggagttggacgccgccgacgaactggccgggctg
cgtgagcggttcgtgctggacgacgtggtctacctggacggcaactcgctcggcgccctg
ccggcgcacgtccccggccgcgtcgaggacgtcgtacggcggcagtggggtgagctgcgc
atccggtcctgggacgagagcggctggtggacggcgccggagcggatcggcgaccggata
gccccgctcgtcggggccgccgccgggcagatcgtggtgggcgactccacgagcgtcaac
gtcttcaaggcgttggtcgccgccgtgcggatggcgggcgagggacgcgacgagatcctc
gtcgacgccaccaccttccccacggacggctacatcgccgagtccgcggcccggatgacg
gggtgcacgttgcgcccggtggcaccggccgaggcgggtgcggcactgtccggccgtacc
gccgccgtgctgctcaaccacgtcgactaccgcaccggacggctgtacgacctgcccgcg
ctcaccaccgcggtccacgctgcgggcgcgatcgcggtctgggacctgtgccacagcgcg
ggcgcgctgccggtcggcctggacgagcacggggtcgacctggccgtcggctgcacctac
aagtacctcaacggcggcccgggtgcaccggcctacctgtacgtccgccgtgacctccag
gaccgtttcgactccccgctgcccggctggaactcccacgcggagcccttcgggatgcgg
cccggctacgagccggcgtccggggcggtgcgcggccgggtcggcacgccggacatcctg
tccatgctggccctggaggccgcgctggacgtctgggacggggtgtcggtagaggcggtg
cgggcgaagtccctggccctgacggacttcttcctggagtgcgtggcggcgtacaccccg
gccggccgggtggagtccgtgacgccggccgcccacgcggagcgcggcagccaggtcgcg
ctgcgctgtgacgacgccggtgaggtgatggagcggctgatcgagcggggggtggtcggc
gacttccggcacccggacgtcctgcgcttcggcttcacgccgctgtatgtcggtttcgcg
gacgtcgagcgggcggcccgggtgctgggggagacggtcgcggggtag

DBGET integrated database retrieval system